KEGG   Capsicum annuum: 107839845Help
Entry
107839845         CDS       T04646                                 

Definition
(RefSeq) non-lysosomal glucosylceramidase
  KO
K17108  non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
cann  Capsicum annuum
Pathway
cann00511  Other glycan degradation
cann00600  Sphingolipid metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    107839845
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    107839845
Enzymes [BR:cann01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     107839845
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF608 Glyco_hydr_116N EF-hand_5 EF-hand_1
Motif
Other DBs
NCBI-GeneID: 107839845
NCBI-ProteinID: XP_016538969
UniProt: A0A1U8E583
Position
8
AA seq 955 aa AA seqDB search
MTDSTTLSGDMLINGSKKGEEECCKHREFKVDPANLPSLTWQRKLNCDDISLSEFNLKLK
EMVSMAPLGFRLWRYLQEEKAKGKDAIFINPFMKRVYSSCQGVPIGGMGAGSIGRSFKGE
FLRWQIFPRICEDKPVLADQFSIFVTRPNGEKYSTVLCPRTPNDSSASGIGSWDWNLGGQ
NSTYHALYPRAWTVYDGEPDPALRIVCRQISPFIPHNYKESSLPTAVFTFTLHNLGKTSA
DVTLVFTLANSAGGDSGISGHHFNSKFRTEDGVHGVLLHHMTGKELPSVTFAVAAEENDA
VHISECPFFVISGDSQGITAKDMWDEVKKHGSFDHLQSEEMSMPSEPGSLIGAAVAASLT
IPADDVRSATFSLAWACPEINFASGRTYHRRYTKFYGTMGHAAAKIAHDAIQDHTQWESQ
IEEWQKTIIEDKRLPEWYPITLFNELYYLNAGGTIWTDGLPPVQRRLSTIEKKFSIDRSS
SDVKRSADPTHSDDTAVLILERMGSVLEELQTPASVNAAFGTNLLQKGEENVGQFLYLEG
IEYHMCNTYDVHFYASFALTMLFPKLELSIQRDFAAAVMMHDPGKRMLLEDGMSATRNVV
GALPHDIGMDDPWFEVNYYCLYNTDRWKDLNPKFVLQVYRDFVATGDKKFAEAVWPSVYM
AMAFMEQFDKDGDGMIENEGFPDQTYDVWSVSGVSAYCGGLWLAALQAASALAREVGDKG
SEDYFWFKFQKAKEVYQKLWNGSYFNYDNSGSAVSSSIQADQLAGQWYARACGLLPIVDE
EKAKTALETVFNFNVMKVKDGRRGAVNGMRPNGEPDSSSLQSREIWSGVTYAVAAAMIQE
DMADTGFKTAAGVYETVWSENGFGYAFQTPEGWNTEGRYRALGYMRPLAIWAMQWALNPP
KIPKQEMKPELEADSLSRQHAGFQTVARFLKLPKEKDARSVFQVLFDYTCKRMTG
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atgactgattcaactactttatcaggagatatgttgattaatggatccaaaaaaggagaa
gaagaatgttgtaagcatcgcgagttcaaggttgacccagcaaatcttccatctttgact
tggcagcgcaagttaaactgtgatgatatctccctttcagaattcaatcttaagctgaaa
gaaatggtctctatggctccattgggtttccgtctatggagatatctacaagaagaaaaa
gccaaaggaaaggatgctatatttatcaatcctttcatgaaaagggtctactcatcatgc
caaggcgttcctattggtggaatgggtgcaggaagcataggtagaagcttcaaaggtgaa
tttttgcgctggcaaatatttcctaggatatgtgaagataaaccagttctggcagaccaa
ttttcaatatttgttacacgtcctaatggtgaaaaatattctactgtgttatgcccgaga
actccaaatgattcgtcggcttctggaataggatcttgggactggaatttgggtggccaa
aattctacatatcatgctctttatccaagagcatggactgtatatgatggggaacctgat
ccagcactcaggatagtatgccgtcagatctctccttttatcccccacaactacaaagag
agcagcttacctacagcagtctttactttcacgctgcataacttgggaaagacgtctgca
gatgtcactttagttttcaccttggcaaattctgctggtggagattctggaatttctggc
catcatttcaattcaaagtttagaacggaagatggagtccatggcgtactcttgcaccac
atgactggcaaagaactgccttctgtaacttttgcagttgcagcagaggaaaatgatgca
gttcacatctctgagtgccctttctttgtgatatcaggagactcccaaggaattacagca
aaagatatgtgggatgaagtaaaaaagcatggatcttttgaccaccttcaatctgaggaa
atgtcaatgccttctgaaccgggatcacttattggagcggcagttgcagcctcactaact
attccagcagatgatgtaagaagtgcaacattctcattggcatgggcctgccctgaaatt
aattttgcaagtggtagaacttatcacaggcgctacacaaagttttatggtactatgggt
catgctgctgcaaaaattgcacatgatgctatccaagatcatactcagtgggagtcacaa
atagaagaatggcagaaaactattattgaagacaagaggcttcccgaatggtacccgata
actctcttcaatgagctctattatttaaatgcaggagggacaatttggactgatggattg
ccacccgttcaaagacgtttatcaacaattgagaaaaaattttccatagatagatctagt
tcggatgttaagagaagtgctgatccaacccattcggatgacactgctgttctcattctt
gaaaggatgggctcagtgcttgaggaacttcaaactcctgcttctgtaaatgctgctttc
ggaacaaatcttcttcagaagggagaggaaaatgtaggccagttcctctaccttgaagga
attgaatatcacatgtgtaacacatatgatgttcatttttatgcatcgtttgctttgact
atgctattcccaaaacttgaacttagtatacaacgagactttgcagctgctgtgatgatg
catgatcctggtaagagaatgctcttggaagatggaatgtcagcgacaaggaatgttgtt
ggcgcacttcctcatgatattggaatggatgatccatggtttgaagtaaattactattgc
ctgtataacacagataggtggaaagatttgaacccaaaatttgttcttcaagtttacagg
gattttgttgcgaccggtgacaaaaagtttgctgaagctgtttggccatctgtgtatatg
gcaatggctttcatggaacaatttgataaggatggggatgggatgatagaaaatgaagga
tttcctgatcagacatatgatgtatggtctgtctctggtgtgagtgcttactgtggtggc
ctatggttggcagctttgcaggctgcatcagccctagctcgagaagttggtgacaagggt
tctgaagactacttttggtttaagttccaaaaagcaaaggaagtttatcaaaaattgtgg
aatggttcttactttaactatgacaatagtggcagtgccgtaagctcatccattcaagct
gatcaattggctggacaatggtatgctcgagcatgtggtcttctaccaatagttgatgaa
gaaaaagctaaaactgcacttgagacagtgttcaatttcaatgtcatgaaggtcaaggat
gggaggcgaggagcagtgaatgggatgcggcccaatggagaacctgactcatctagtttg
cagtcaagggagatatggtctggagttacatatgctgtagctgcagccatgattcaggaa
gacatggcggatacgggatttaaaactgcagctggagtctatgaaaccgtttggtctgaa
aatggctttggctatgcttttcagaccccagaaggttggaacacagaaggccgctacaga
gctctgggttacatgcggcctttagcaatctgggcaatgcaatgggcattaaacccacct
aagattcctaagcaagagatgaaaccagaattggaggcagattcattatctaggcaacat
gctggttttcaaacggtagctcgttttctaaagctgcccaaagagaaagatgctagaagt
gtctttcaggtcctttttgattacacatgtaaaagaatgacaggctaa

DBGET integrated database retrieval system