KEGG   Capsicum annuum: 107842494Help
Entry
107842494         CDS       T04646                                 

Gene name
TDC2
Definition
(RefSeq) tyrosine decarboxylase 1-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
cann  Capsicum annuum
Pathway
cann00350  Tyrosine metabolism
cann00360  Phenylalanine metabolism
cann00380  Tryptophan metabolism
cann00950  Isoquinoline alkaloid biosynthesis
cann00965  Betalain biosynthesis
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107842494 (TDC2)
   00360 Phenylalanine metabolism
    107842494 (TDC2)
   00380 Tryptophan metabolism
    107842494 (TDC2)
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    107842494 (TDC2)
   00950 Isoquinoline alkaloid biosynthesis
    107842494 (TDC2)
   00965 Betalain biosynthesis
    107842494 (TDC2)
 09150 Organismal Systems
  09158 Development and regeneration
   04361 Axon regeneration
    107842494 (TDC2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cann04147]
    107842494 (TDC2)
Enzymes [BR:cann01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     107842494 (TDC2)
    4.1.1.105  L-tryptophan decarboxylase
     107842494 (TDC2)
Exosome [BR:cann04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107842494 (TDC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Thioredoxin_13
Motif
Other DBs
NCBI-GeneID: 107842494
NCBI-ProteinID: XP_016541857
UniProt: C0LIF0 A0A1U8E3N3
Position
9
AA seq 487 aa AA seqDB search
MEGELKPMDAEQLREYGHKMVDFIADYYKNIETLPVLSQVEPGYLRKLLPETAPAHSETL
QNVLEDVQTKILPGVTHWQSPDYFAYFPSNSSVAGFLGEMLSAGINMVGFSWITSPAATE
LEMIVLDWLAKALKLPDEFLSTGQGGGVIQGTASEAVLVVLLAARDKVLRRVGKDAISKL
VVYCSDQTHSSLQKACQIGGIHPENFRVLKTDPSRDYALSPDTLSEAVSHDMATDLIPFF
FCATIGTTSSTAVDPLLDLGKIAQSNSIWFHVDAAYAGSACICPEYRGYINGVEEAHSFN
MNAHKWFLTNFDCSALWVKDRSALIQSLSTNPEYLKNKASQGNLVVDYKDWQVPLGRRFR
SLKLWMVLRLYGLEKLQAYIRNHIQLAKLFEKLVAQDQRFEIVTPRKFSLVCFRLLPPPS
NEDYANKLNHNLLDSVNSTGKLFISHTLLSDKYILRFAVGAPLTEERHIVGAWKVLQDEA
ATLLSKC
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggagggggaattgaagcccatggatgctgagcaactgagagaatatggtcacaagatg
gtagatttcattgctgattactacaaaaacattgagaccctccctgttctcagccaagtt
gagcctggttatcttcgtaagcttttgcctgaaaccgcacctgctcattctgagacgttg
caaaacgttcttgaagatgttcaaacaaaaatattaccgggtgtgacccactggcagagc
ccagattactttgcatattttccttcaaatagtagtgtggctggatttttgggggaaatg
ctcagtgccgggattaacatggtgggctttagttggataacttctccagcagcgacagaa
ctcgaaatgatcgttcttgattggcttgctaaagcgcttaagttgcctgatgaattcctt
tcaacaggtcaaggaggtggagtgatacagggaacagcaagtgaagctgttctagttgtg
cttttagctgctcgggacaaggttcttagaagagtcggaaaagatgcaattagcaagctt
gtggtctattgttctgatcaaactcattcttctttacagaaagcttgccagataggaggg
attcatcctgagaactttcgggtgctgaaaacagacccatccagggattatgctctttct
cctgatacactttcagaagctgtatcacatgacatggccactgatttaatacccttcttc
ttttgtgctactattggtacaacatcttccactgctgtggatcctttgcttgacctggga
aagatcgcccagagtaatagcatatggtttcatgtggatgcggcctatgctggaagtgca
tgtatctgtccggaataccggggctatatcaatggtgtagaagaagctcattctttcaac
atgaatgcacacaagtggttcctgacaaactttgactgttcagctctttgggtcaaggac
cggagtgcactcatccagtcactgtcaacaaatcctgagtatctcaaaaacaaagcctct
caaggaaacttggttgtggattacaaagattggcaagttcctcttggacgcaggttcaga
tcattgaagctgtggatggtattgagactctatgggctggaaaagcttcaagcttacata
agaaaccatatacaactagcaaagctgtttgagaaactcgttgctcaagaccagaggttt
gagattgtcacccctcggaagttctcattggtttgttttcgcctacttccacccccaagt
aatgaagattatgccaacaaactgaaccataacctgctagattctgtcaactcaactggg
aaactttttatttctcacacgcttctttcagataaatacatactacggtttgcagtaggg
gctccactgacagaagagaggcacattgttggagcttggaaagttttacaagatgaggct
gctacattgttaagtaaatgttaa

DBGET integrated database retrieval system