KEGG   Capsicum annuum: 107842504Help
Entry
107842504         CDS       T04646                                 

Definition
(RefSeq) probable glutathione peroxidase 4
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cann  Capsicum annuum
Pathway
cann00480  Glutathione metabolism
cann00590  Arachidonic acid metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107842504
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107842504
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     107842504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin AHJR-like
Motif
Other DBs
NCBI-GeneID: 107842504
NCBI-ProteinID: XP_016541874
UniProt: A0A1U8EDD2 A0A2G2YT13
Position
9
AA seq 170 aa AA seqDB search
MGASKSVPQKSIHEFTVKDIKGKNVDLSIYKGKVLLVVNVASKCGFTSTNYTQLSQLYNQ
FKDQGFEILAFPCNQFLKQEPGTSQEAQEFACIRFSAEYPIFQKVRVNGSNAAPVYKFLK
ASKGGFLSSSIKWNFTKFLVDKEGQVVRRYGSTTPPLSIKADIQKALGEN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggggcttctaaatcagttccacagaaatcaatccatgaattcactgtcaaggatata
aaagggaaaaatgtagacctaagtatctacaagggcaaagtgcttcttgtcgttaatgtt
gcctccaaatgtggattcacaagcaccaattatacccaattgtctcaactctacaaccaa
ttcaaggatcaaggttttgaaatcttggccttcccctgcaaccaatttttgaagcaagag
cctggtacgagtcaggaagctcaagaatttgcttgcataagatttagtgcagaatatccc
attttccaaaaggtgcgagtgaatggttcaaatgcggcaccagtctacaaattccttaaa
gcaagcaaaggtggttttctcagttccagcattaaatggaatttcaccaagtttttggtt
gataaggaggggcaagttgtccgacgctatggctcaaccactccaccattatcaatcaag
gcagatatccagaaagcattaggggagaattga

DBGET integrated database retrieval system