KEGG   Capsicum annuum: 107843191
Entry
107843191         CDS       T04646                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
cann  Capsicum annuum
Pathway
cann00100  Steroid biosynthesis
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Module
cann_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    107843191
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     107843191
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 107843191
NCBI-ProteinID: XP_016542888
UniProt: A0A1U8E6M8
Position
9
AA seq 369 aa
MDLNQLFISLSPSYTSVAMLLSFFLYLATVGSILPGKLVPGVTLSDGTRLHYRCNGLLSL
LLLVLLLGVGSQMNLVSPTAIADRGLELLSTTFIFSVLVTLMLYLVGLNSRAKSSSLKPH
VSGNLIHDWWFGIQLNPEFMGIDLKFFFVRAGMMGWLLINLSVLAKCIIEDKLSQSMILY
QIFCGLYILDYFFYEEFMTSTWDIIAERLGFMLVFGDLVFIPFTFSIQGWWLLSNKVELK
TAAIIANCLVFLVGYLVFRGANKQKHMFKKDPKAPIWGKPPKVIGGKLLASGYWGIARHC
NYLGDLLLASSFSLPCGISSVVPYFYPIYLLILLIWRERRDEARCAEKYKDVWAEYRKLV
PYRILPYVY
NT seq 1110 nt   +upstreamnt  +downstreamnt
atggatctcaatcaactcttcatttcactctctccatcatacacttcggttgctatgttg
ctatctttttttctatatttagctacagttggatctattctacccggaaaacttgttcct
ggggtgactttatctgacggaactcgccttcattatcgttgcaatggtttgttatcactt
ctgttgttggttttgcttctcggagttgggtcgcagatgaatcttgtttcacctactgct
atagcagacagaggacttgaacttttgtcgacaacctttatctttagtgttcttgtgacg
ttgatgctttatttggttggcttgaactcacgtgcgaagagttcgtcactgaaacctcac
gtctcaggaaatttgatccatgactggtggttcgggatacaactaaatcctgaatttatg
ggcattgatctcaaatttttctttgttagagctggtatgatgggatggttacttatcaat
ctttcagttcttgcaaaatgtattatagaggacaaattaagccaatcaatgattctctac
cagatattttgtgggctctacatccttgattacttcttctatgaagagttcatgacttcc
acatgggatataatcgcagagaggttgggcttcatgttggtttttggtgatctagtattt
ataccgttcaccttcagtattcagggttggtggcttttgagtaacaaagttgagctaaaa
acggcagcaataattgccaattgcctcgtctttcttgttgggtaccttgtgttcagagga
gccaacaagcagaagcatatgtttaaaaaggatcccaaggcacccatatggggtaagcct
ccaaaagttatcggagggaagttgcttgcttccggctattggggcattgcacgacactgt
aattacctcggggatttgttgctggcatcgtcttttagtttgccttgtggtataagttct
gtggttccatacttttatcccatatatcttctcattctgctaatatggagggagagaagg
gatgaagctagatgcgcggagaaatacaaagacgtgtgggctgaataccgtaagcttgtt
ccttacaggatcttaccttatgtttactag

DBGET integrated database retrieval system