KEGG   Capsicum annuum: 107844721Help
Entry
107844721         CDS       T04646                                 

Definition
(RefSeq) probable protein kinase At2g41970
Organism
cann  Capsicum annuum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ABC1
Motif
Other DBs
NCBI-GeneID: 107844721
NCBI-ProteinID: XP_016544564
UniProt: A0A1U8EL16
Position
10
AA seq 360 aa AA seqDB search
MIVFVQMSTFLIRSYHIVNEFIVLYCIVASDRGEPRSAARGGTPQKVLPIEAPVFTLDEL
NRMTGNFGQKALVGEGSYGRVFCAKLSNGQQVAIKKLDTSSSPEPDSDFAAQLSTVSRLK
NEHFMTLMGYCLEGNNRILVYEFATKGSLHDVLHGRKGVQGAEPGPVLTWNQRVKIAYGA
AKGIEYLHEKVQPPIVHRDVRSSNALLFDDFTAKIADFNISNQSSDTAARLHSTRVLGTF
GYHAPEYAMTGQITQKSDVYSFGVVLLELLTGRKPVDHTMPKGQQSLVTWATPRLSEDKV
KQCVDPKLNNDYPPKAIAKLAAVAALCVQYEADFRPNMTIVVKALQPLLNSMPSRPDSQA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgattgttttcgtgcagatgagcacatttttgattcgatcatatcatattgtaaatgaa
tttattgtattgtattgtattgtagcgagtgatagaggagagccgaggagcgctgcaaga
ggtggaactcctcagaaagtactaccgattgaggcgccagttttcaccttggatgagcta
aaccgaatgactggaaatttcggtcagaaagctttggttggagagggatcttatggccgc
gttttttgcgctaaattaagcaatggacagcaagtagcaatcaagaagttggatactagt
tcttcacctgaaccagattctgactttgcagctcagttatcaacggtttcaagacttaaa
aacgagcatttcatgactctgatgggctattgtctcgaagggaacaatcgtatattggtc
tatgagtttgcgacaaagggatctttacacgatgttttacatggtagaaaaggcgtacaa
ggtgctgagcccggtccagttcttacctggaatcaaagagttaaaattgcttatggtgca
gcaaaaggcatagagtatctacacgaaaaagttcagccacctatagttcatcgcgatgtc
aggtccagcaacgcgttgctctttgatgattttacagcgaagattgctgatttcaacatc
tcgaaccagtcttctgatacagcagcgcgtctgcattccactcgagttttgggaactttt
ggctaccatgcaccagagtatgccatgacaggacagattacgcagaaaagtgacgtgtat
agttttggcgttgttctcttagaactcttgacaggaaggaagccagtagatcatacaatg
cctaaaggacaacagagtcttgtcacttgggcaactccaagactgagtgaagacaaagtg
aagcaatgtgttgatccaaagctaaataatgactatcctccaaaagcaattgctaagttg
gcagctgttgcagcactttgtgttcaatacgaggccgattttcgacctaatatgaccatt
gttgtcaaagcactgcaaccactactcaactcaatgccatcaagaccagactcacaagca
tag

DBGET integrated database retrieval system