KEGG   Capsicum annuum: 107845980Help
Entry
107845980         CDS       T04646                                 

Definition
(RefSeq) fructose-1,6-bisphosphatase, chloroplastic-like
  KO
K03841  fructose-1,6-bisphosphatase I [EC:3.1.3.11]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00030  Pentose phosphate pathway
cann00051  Fructose and mannose metabolism
cann00710  Carbon fixation in photosynthetic organisms
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Module
cann_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
cann_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cann_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
cann_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107845980
   00030 Pentose phosphate pathway
    107845980
   00051 Fructose and mannose metabolism
    107845980
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    107845980
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cann04147]
    107845980
Enzymes [BR:cann01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     107845980
Exosome [BR:cann04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107845980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FBPase
Motif
Other DBs
NCBI-GeneID: 107845980
NCBI-ProteinID: XP_016545995
UniProt: A0A1U8ERL7
Position
10
AA seq 408 aa AA seqDB search
MAASTATTPTTSNLCFSNSHSLFQHKRTSFLCAKNSIVKRKCKHKGAVTCMVLEKSSTAE
PTKPKKQNAYKLQTLTSWLLKQEQDGVIDAELTIVLSSISMACKQIASLVQRAGISKLTE
VHGAVNAQGEDQKKLDVVSNEVFSNCLRASGRTGIIASEEEDVPVAVEESYYGNYIVVFD
PLDGSSNIDAAVSTGSIFGIYSPNDDCLLDLEDTTMLDSVEQRCIVNVCQPGNNLLAAGY
CMYSSAVIFVLSLGNGVFSFTLDPMFGEFILTQEHIQIPKAGKIYAFNEGNYQLWDDRLK
KYIDHLKDPGPSGNPYSSRYIGSLVGDFHRTLLYGGIYGYPRDKKNRNGKLRLLYECAPM
SILVEQAGGKGSDGQQRILDIQPAEIHQRVPLYIGSIEEVEKLEKYLS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggcagcatcaacagccacaacaccaacgacttcaaacctttgcttctcaaactctcat
tcccttttccaacacaaaaggacttcatttttgtgcgcaaaaaacagcatagtaaagaga
aagtgtaagcacaagggagctgtgacgtgcatggtcttggaaaagagtagtacggctgag
cctacaaaacccaagaaacagaatgcgtataagctgcagaccttaactagctggctgttg
aaacaagaacaagatggggttatcgatgctgaacttactattgttctttcgagtatttcg
atggcttgtaagcagattgcttcattggtacaaagagctggcatttccaaacttactgaa
gttcatggtgctgttaatgctcaaggagaagaccagaagaagcttgatgttgtctctaac
gaggtattctcaaattgtctaagggcaagtggccggacagggattatagcgtcggaggaa
gaggatgtgcccgtggcagtagaggagagttactatgggaactatatcgtggtgtttgat
cctcttgatggatcatcaaatattgatgctgctgtatctactggttctatctttggaatt
tacagcccaaatgatgattgcctccttgatcttgaagatactaccatgcttgacagtgtg
gagcagaggtgcatagtgaatgtgtgccaaccagggaacaatcttctagcagcagggtac
tgcatgtactcgagcgctgtgatcttcgtgctctcgttgggaaatggagtcttctcattc
accttggatccaatgtttggagaattcattctgactcaagaacacatccaaataccaaag
gctggaaagatctacgcattcaatgaaggaaactaccagttatgggatgacaggttgaag
aagtacatcgatcacttgaaggaccccggtcctagtggtaatccttactcctccaggtac
attggcagtttggttggtgattttcataggactcttttatatggtggtatttatggctat
ccgagagacaagaagaacaggaatgggaagttgaggcttttgtatgagtgtgccccgatg
agcattcttgtggaacaagccggtggcaaaggatctgatggccaacaaagaattcttgat
attcaaccagctgagatacatcaacgagttccattgtacattggaagcatagaagaagtt
gaaaaattggagaagtacttatcttaa

DBGET integrated database retrieval system