KEGG   Capsicum annuum: 107848059Help
Entry
107848059         CDS       T04646                                 

Definition
(RefSeq) putative amidase C869.01
  KO
K01426  amidase [EC:3.5.1.4]
Organism
cann  Capsicum annuum
Pathway
cann00330  Arginine and proline metabolism
cann00360  Phenylalanine metabolism
cann00380  Tryptophan metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    107848059
   00360 Phenylalanine metabolism
    107848059
   00380 Tryptophan metabolism
    107848059
Enzymes [BR:cann01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     107848059
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 107848059
NCBI-ProteinID: XP_016548205
UniProt: A0A1U8EXS4 A0A2G2YGW0
Position
11
AA seq 506 aa AA seqDB search
MSILSILFINLCMILSIFSNNSEAKTFSFKETTIDDIQIAFKQNKLTSRQLVEYYLGEIQ
KANPILKGIIEVNPDALFLADKADQEQKSGALLSSRLHGIPVLVKDNIATKDKLNTTAGS
LALVGSIVPQDAGVVKKLRKAGAIILGKATMTEWAAFRSGILPSGWNGRLGQALNPYVAS
ADPSGSSTGSATSVAANLAAVALGTETAGSILSPSNANSVVGIKPTVGLTSRAGVIPISH
RQDTVGPICRTVSDAVEVLDVIVGFDRDDFPATKKASTYIPHGGYRQFLKADGLKDKRLG
ILKDLFGSNDIKAYQHHFNTLRQKGAVLVDNLEIPNIDLVYTAIVNAQDIALVAEFKMDL
NAYLKKLVHTRVRSLADVIAFNKISVSEKFKEYGQDIMVTAEKTNGIGKLEREALSNITK
VCKYGFEKMMKVNKLDALLSPGADIASLLAIGGYPGINVPAGYDKSGVPFGISFGGLKGS
EPTLIEIAYGFEQATHIRKPPPSHPR
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgtctattctttctattctcttcattaatctgtgcatgatattatccatcttcagtaac
aattctgaggcaaaaacattctcatttaaggaaacaactatagatgatattcaaatagct
ttcaagcaaaacaaacttacctcaagacaacttgtggagtactatctaggtgaaatccag
aaagctaatccaattcttaaagggatcatagaagtgaatccagatgcactctttcttgca
gataaagctgatcaagaacaaaaatcgggggcgctactgtccagcaggctacatggtata
ccagttcttgtcaaggacaacattgcaacaaaagataagcttaacacaacagcaggatca
ctagcacttgttggatccattgtgccacaagatgctggtgtagtcaagaagttgaggaag
gctggtgctatcatacttggcaaggctactatgactgaatgggctgcttttagatctggt
attctgcctagtggttggaatggcagacttggacaagctctgaatccttatgtagcaagt
gctgatccatcaggttcaagcactggttctgcaacatcagtagcagcaaaccttgcagca
gtagcattggggacagaaacagcaggctccattctatctccatccaatgctaattcagtt
gttggaatcaaaccaactgttggcctcactagcagggcaggtgttatcccaatttcacat
aggcaagacactgttgggccaatctgcaggacagtatctgatgctgttgaggttcttgat
gtcattgttggcttcgatcgagatgattttccagcaactaaaaaggcttcgacttacatt
cctcacggtggatataggcaatttcttaaggctgatgggctcaaagataaaagactaggt
attttaaaggacctttttggttccaatgatatcaaagcttaccagcaccattttaacacc
ttaaggcaaaaaggagcagtattagttgacaacctggaaatacctaacatcgacttggtc
tacactgctattgtcaatgctcaagacatagcacttgttgctgaattcaagatggaccta
aatgcatatcttaagaagttagtccacactcgagtccgatccttggcagatgtcatagcc
tttaacaagatttcagtttctgaaaagttcaaagaatatggtcaagacataatggtgaca
gctgagaagacgaatggaatagggaaattggaaagggaggcactgagcaacataacaaaa
gtatgcaaatacgggtttgagaagatgatgaaagttaataagttagacgccttattgtca
cctggtgcagacattgctagtcttctcgcgataggaggttatccagggatcaatgtacct
gctggttatgataaaagtggagttccattcggaatttcctttggaggactaaagggttct
gagccaacactcattgagattgcgtatggctttgaacaagcaactcatatcagaaagccc
cctccttcacatcctcgatag

DBGET integrated database retrieval system