KEGG   Capsicum annuum: 107849508Help
Entry
107849508         CDS       T04646                                 

Definition
(RefSeq) receptor-like protein kinase FERONIA
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cann01001]
    107849508
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107849508
Protein kinases [BR:cann01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107849508
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Malectin_like Malectin APH
Motif
Other DBs
NCBI-GeneID: 107849508
NCBI-ProteinID: XP_016549557
UniProt: A0A1U8EQR3
Position
12
AA seq 1194 aa AA seqDB search
MSSCFSAISSVVRRLFYLKLIIYHTLQTQTISASFYNKMNMLFSHLFVLSVFMFMDHLII
CAATNVHENVAISCGASGNFAGTDGRVWVGDASYISSLLQLKGKSLKSSVPPPFSDSVPY
KSARTSRHEFTYQFSVKPGQKFIRMHFKPASYKGFKKSKAIFTVKTGEHTLLSDFTPTLA
EGMSYFKKEFCINVQEDETLSITFIPSRKPGFVEDTYAFVNGIEVVSMPAGLYFTPDGDV
GVTVVGRKYRFYIDNNTALETIQRINVGGNSISSLEDAAMFRDWEDDTNYLKEVGGFSIN
RAVAIRYTYSATHIAPKEVYQTARTVGARCHSNVCKLTWDVPLDLGFRYLVRLHFCEIEP
AMTKEGQRNFTIVINNQKAEEEADVIKWSGGHGISVYKDYVAIMEGDRREGKHKLSIVLQ
PNFATISKRSNAILNGIEVFKISNPDNNLGGVSPVHPTTSSTPAKSKSVLFATKNKIATV
LTFVVTLINVALYYIRCNSEINSGKTNNKLSFREHQCRQFSLDEMVRSTNNFDPQLVIGS
GGFGTVYKGDIDGGETAVAVKRLKPGSRQGENEFWAEIKMLPIHCHENLLSLIGYCKEGD
EMLLVYEYMSRGTLAEHLHKMNRSGHKNSSLSWEQRLKIAIGAARGLDFLHTSQDRVIHR
DVKSSNILLDENWGSKISDFGLSKMGPGNESATHVITEVKGTFGYLDPEYFLTKRLTWKT
DVYAFGVVLFELLSGRAAVDMQLPEEQHALAAWAKQCIVEEQVHKLIDQNLAGPISSTSL
KAFVGTAAKCLDDHPHERPPMSKVVKSLELALVFQQSAGEGIISFDDTSTSHSKVGAERA
SSIKEGRNGIDITKRKAIPMKKVKSKDRSLDIASPRWRDFLGLFPKAPPKPKPSPTQPQG
LHHFSLFKMLKATKDFHESLRIGYLGADNAYVGVINGQNVAVRRSHTAQSRLHMVSELQA
KTTMTPLPSHVNMVSLIGFCRNYTEMILVYDYAAGGTVHDYLRDPDKNPLRWKQRLEICI
GAAEGLNYLRSILKITILHRIFDSSYIWLDENCVAKVSEVSWSKTRGINKAGAVPEGGYL
DSDCLRDERLTEKSYVYSFGLVLFEMLCANEALNHWLNEGQISLAQWIKTSFMTATAHCI
HPCLVGRISPDCFALFVNTALNCLHDEGIKRPSMSDIITSLKEALNLQEAYKIT
NT seq 3585 nt NT seq  +upstreamnt  +downstreamnt
atgtccagttgcttctctgcaatttcttctgtagtgcgtaggctattctacctcaagttg
attatttatcacactcttcaaactcaaacaatcagtgcttctttctacaacaaaatgaac
atgttgttctctcaccttttcgtactctcagtgtttatgtttatggatcacttgatcatc
tgtgctgcaaccaacgttcatgaaaacgttgccatttcatgtggtgcctctggcaatttc
gctggaacagatggacgagtatgggttggagatgcaagttacatttcttcactgcttcag
ttgaaggggaaatctcttaagtcaagtgtgcctcctccgttttcagattcagttccttac
aaatcagctcggacatcccgccatgagtttacttaccagttctcagtgaaaccgggacag
aagttcatacgcatgcacttcaagccagcttcatacaaaggtttcaagaagtctaaagcc
atttttactgtcaaaacaggcgagcataccttgcttagtgacttcacccctacccttgct
gagggcatgagctacttcaaaaaggaattttgcatcaatgtacaagaagatgaaacattg
agcataacattcataccatctcgaaaaccaggctttgtagaagacacttatgctttcgtc
aatggaatcgaggttgtttccatgcctgccggtctgtattttacgccagatggtgatgtg
ggagtaactgtggttggacggaagtacagattctacattgacaacaacacagcactagag
acaattcagcgaataaatgttggcggaaactctatttcatccttggaagatgcagccatg
ttccgggactgggaagatgacactaactacctgaaagaagtcggtggcttttcaatcaac
agagctgttgcaatcagatatacatactcagcaactcacattgcaccgaaagaagtttac
caaacggctaggacagtgggtgcacgctgccattcaaatgtttgtaagctcacatgggac
gttccacttgatttgggattcagataccttgttaggctccacttttgtgaaatcgaacct
gcgatgacaaaggaaggtcaacggaatttcactattgtcataaacaaccagaaagctgaa
gaggaggctgatgtgatcaaatggagtgggggacatggaatttctgtatacaaggactat
gttgccattatggagggtgatagaagggaaggtaagcacaaactttctatagttttgcag
ccgaatttcgctacaatcagtaaacgcagtaacgcaatcttgaatgggatagaagtattc
aagataagcaaccccgacaacaatcttggcggtgtgagccctgtgcatcctactaccagt
tcaacaccagcgaaatcgaaatccgtgctgtttgctacaaaaaataaaattgcaactgta
ctgacatttgtagtcactttgatcaatgttgctctttattacattaggtgtaattcagag
attaactctggcaagacgaataacaaactatcttttagagagcatcagtgtcgtcagttc
tcattggatgagatggttagatcaaccaacaattttgatcctcagcttgtcattggaagc
ggtggatttggcacagtatacaagggggatattgatggcggagagaccgctgtagcagtt
aagcgactgaagccaggatctagacaaggggagaatgagttttgggctgaaatcaaaatg
ttacctatccactgccacgagaaccttctatccctaattggttactgcaaggaaggtgat
gagatgttattagtttatgaatacatgagtcgaggaacacttgccgagcacctccacaaa
atgaacagaagtggtcataagaactcctctctctcttgggaacaacggctcaaaattgct
ataggtgctgcacgtggattggatttccttcatacatctcaagatagggtgatacatcgt
gatgttaaaagctcaaacattctgttggatgaaaactgggggagtaagatttcagatttt
ggtttgtccaaaatgggacctggaaatgaatcagctactcatgttattacagaagttaaa
ggcacatttgggtacctcgatcctgagtacttcctgactaaaagattgacatggaaaact
gatgtatacgcttttggagtagtactatttgaactactctcaggaagggcggcagttgat
atgcaactgcctgaggagcaacacgcacttgcagcatgggctaagcaatgcatcgtggaa
gaacaagttcataagcttattgaccagaatctggcggggcctatctcatcaactagtttg
aaggcgtttgtaggaactgcagcgaaatgcttggatgatcatccacatgaacggcctcca
atgtcgaaagtagtgaaaagcctggaattagcattagtttttcagcagagtgcaggtgaa
ggcatcatttcatttgatgacacatcaacatctcattcaaaggttggagcggaaagggca
tcatccatcaaagagggtcgtaatggcattgacataacgaaaaggaaagccattccaatg
aaaaaggtaaaatctaaggatagaagtctcgatatcgcctcaccaagatggcgggatttt
cttggtctttttccaaaagcaccgccaaagccaaaaccttcaccaacacagccacaagga
cttcaccacttctccctctttaagatgctaaaggctacaaaagatttccatgagagcctg
agaataggttatctaggagctgacaacgcatatgtaggcgtcataaatggtcaaaatgtt
gccgtcagacggtcacatactgcacagtcaagacttcacatggttagtgagttgcaagct
aaaacaacaatgactcccttgcccagccatgtgaacatggtgtctctgattggattttgc
agaaattatacagaaatgatccttgtctatgactatgcagctggagggaccgtgcacgat
tatctccgtgaccctgataagaatcctctccgatggaagcaaaggcttgagatctgcatt
ggtgctgcagagggtttgaactatcttcggtccatactgaagataacaattctccatcgc
attttcgactcctcctatatttggttggatgagaattgtgtagccaaagtttcagaggtt
agctggtcaaaaacacgagggatcaataaggcgggggcagttcctgaaggcggatatttg
gattcagactgcttacgagatgaaagattgacagaaaaatcatatgtatactcattcggc
ttggtgttgttcgaaatgctatgtgccaatgaagcattgaaccattggctgaatgaggga
caaatcagtctagcccaatggattaaaacatcttttatgaccgcgactgcccattgcatt
cacccatgcttggttggaagaatatcacctgactgctttgcgctgtttgtaaatactgca
cttaattgcctgcatgacgagggtatcaaacgaccatcaatgagtgatataatcacaagt
ctcaaggaagcactcaatctgcaagaggcgtacaagattacttag

DBGET integrated database retrieval system