KEGG   Capsicum annuum: 107849694Help
Entry
107849694         CDS       T04646                                 

Definition
(RefSeq) glutathione S-transferase 2-like
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
cann  Capsicum annuum
Pathway
cann00350  Tyrosine metabolism
cann01100  Metabolic pathways
Module
cann_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107849694
Enzymes [BR:cann01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     107849694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N
Motif
Other DBs
NCBI-GeneID: 107849694
NCBI-ProteinID: XP_016549738
UniProt: A0A1U8ERF4
Position
12
AA seq 96 aa AA seqDB search
MYGIEYLKLNPLAYVPTLVDGDAVIVDSFAIIMYLEEKYPQRALLPQDHQKKAINYQGER
VCCLDPCQWICVESCYHIYPLLEIKSEKHRKTKSIY
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaatagaatacttgaagctgaatcccctagcatacgtgcccacgctggttgat
ggagatgcagtaattgtcgactcttttgctatcataatgtatctggaagagaagtatccc
caacgagcattgttgcctcaggatcatcagaaaaaagcaatcaactatcagggagagcga
gtatgctgcctggacccttgtcaatggatatgcgttgaatcatgttaccatatctaccca
ttgcttgagatcaaatctgagaagcatcggaaaactaaatcaatttattga

DBGET integrated database retrieval system