KEGG   Capsicum annuum: 107850388Help
Entry
107850388         CDS       T04646                                 

Definition
(RefSeq) alcohol dehydrogenase-like 7
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00071  Fatty acid degradation
cann00350  Tyrosine metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107850388
  09103 Lipid metabolism
   00071 Fatty acid degradation
    107850388
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107850388
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     107850388
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     107850388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C PEP-CTERM UDPG_MGDP_dh_N TrkA_N
Motif
Other DBs
NCBI-GeneID: 107850388
NCBI-ProteinID: XP_016550362
UniProt: A0A1U8ET13
Position
12
AA seq 389 aa AA seqDB search
MGTTQADLTRTAGKPIHCKAAVARKPGEPLVIEEVIVAPPKVHEVRLKIICTSLCHSDVT
FWKLKDFPGCFPRILGHEAFGVVESVGEDVHDLKEGDSVVPIFLPDCAQCIDCTSKKSNN
CSKFEFKVSPWMLRDGTSRFTTVDGETLYHFLSVSSFAEYTVVDIANVMKIDPCVPPNRA
CLFSCGVSTGVGAALKSAKVEPGSTVVIFGLGAIGLAVAEGARISGASRIIGVDINSDKF
EIGKQFGVTDFVNSNSYGDKPISQVINEMTNGGGDYCFECVGMGKLVQEAYACCRKGWGK
TIVLGVDKPGAELTFKSFDVLHLGKTLIGSLFGGLKPKSDIPLLVKRYLDKELQLDKFVT
HEVSFQDINKAFDLLVEGKSLRCVVWMDK
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgggtaccacacaagctgacttgaccagaactgctggaaagccaattcattgcaaagct
gcggtggcaagaaaaccaggagaacctctggtgatagaggaagtgattgtggctccgcct
aaagtccatgaagttcgcctaaaaatcatatgtacttctctctgtcacagtgacgttacc
ttctggaagttgaaagactttcctggatgctttccaagaatattgggccacgaggctttc
ggggttgtggagagtgttggagaagatgtccacgatttaaaagaaggagattcagttgtc
ccgatatttttgcccgactgtgcacaatgtatagattgcacatccaagaagagcaacaat
tgttcaaaattcgaatttaaggtatctccatggatgcttagagatggaacaagtagattc
actaccgttgatggagagactttataccatttcctgtctgtatcaagttttgcggagtac
actgttgtagacattgctaatgtaatgaagatcgatccttgtgttccacctaacagggca
tgcctctttagttgtggagtatcaacaggagtaggtgctgccctgaaatctgcaaaggtt
gaaccaggatcaactgtagtaatatttggtttgggcgcaattggtttagcagttgcggag
ggagcaaggatatctggcgcttcaagaattattggtgtagatataaactctgacaagttc
gaaatagggaaacaatttggagtgactgattttgtcaattccaatagctacggggataaa
cctattagccaggtgataaatgagatgactaacggaggtggtgactactgctttgaatgt
gttggtatgggaaaactcgtgcaggaagcatatgcctgctgtcgaaagggttggggaaag
acaattgtcctaggagttgataaaccgggagcagagctgacatttaaatctttcgacgtt
cttcatttggggaaaactctcataggatcactgtttggaggtctcaaacccaaatctgac
attcctcttcttgtcaaacgctacctcgacaaggaactgcaactggacaagtttgtaaca
cacgaagtgagttttcaagacatcaacaaggcgtttgatttactcgttgaaggaaagagc
ctccgatgtgttgtttggatggataagtga

DBGET integrated database retrieval system