KEGG   Capsicum annuum: 107855185Help
Entry
107855185         CDS       T04646                                 

Definition
(RefSeq) probable LRR receptor-like serine/threonine-protein kinase At1g53420
Organism
cann  Capsicum annuum
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Malectin Pkinase_Tyr LRR_8 LRR_4 LRR_1 APH
Motif
Other DBs
NCBI-GeneID: 107855185
NCBI-ProteinID: XP_016555664
UniProt: A0A1U8FH77
Position
Un
AA seq 982 aa AA seqDB search
MVMFMFIYRVFTCLLLLLVIFEVAVEQATQGPLRRICTTTLYDEKLPNIPPLAKEDEDVI
NDLLGCSGERLSPSCYIESNSVTCDCYPEDHKRCRVVYIDFSYSQLQGVIPAKIGNLQYL
KTLYLNGNNLRGYIPESFKKLDNLSEFSLCDNLLEGAIPPFFGQMSSVKQIYLCKKLFNQ
TIPPELGALPSLEYLDLGYNFLSGKIPAERGNIKSLIGLYLSDNQLSDVLPGQLGNLVNL
EELKLQNNEFIGSLPASFKNLNKLTYFNVRGNNLNGAIPDIFEQWQDLRIMNLMGNNFSA
PLHGQFSKLKSLNRTAYQYLIGGSSSFPDLSGTKFLRLLTLRNCSIADRIPVGLWNLPGL
QYLDLSFNSLFGAIPEVVDNSLVYIYLRKNNLNETIPAWMNANSYVDVSENLFRDVSINP
GQTLNPDLNLFKCCSNEKDKVAKQDQVDFDCKNGTQFYDRLYINCGGESVSVNGRVYEAD
VNPRGESTFFSRSNWGNSSMGSFLWASRNEYILYDCQIQAGDAQLYSSARLSPISLKYYG
FCLKSGVYDVKLHFAEISSSENKVSHSKAGRLFDVDIQGENVLRNFNIEKDAGGVNMAIT
KEFTCVLNNSLEIHLYWSGKGSVLYRSEYYGPLISAITVTPARESNLSTGALAGISVFAL
LLLTTLFIVFSWRFKDIWQGELELVELYPGGLYNYQKIKAATKNFDTANRIGEGGFGTVY
KGTLSNGTAVAVKKLSRTKEGMWEFVEKSRAIAGMKHPNLVTLMGCCLGNNXLLLIYEYI
GTNTLEDALFGSDELRARLDWPTRYRICLGLAEGLAFPHEGSKQEIIHGDIKPANILLDD
DLNPKIYDFGFARLYHKQKTEGTMSYTAPKVKDRPLEVSADVYSFGVVTLIIVRGMKIKN
PRPGGETEYLVDEAQKKDQRGTLMELVDRNLMSYDWEETEMILQLAIQCIDSPSVRPTMS
KIVKILKKEPLIETILIKPEGV
NT seq 2949 nt NT seq  +upstreamnt  +downstreamnt
atggtaatgttcatgtttatttacagggttttcacttgtcttttgctgctgttagtcatt
tttgaggtggctgtagaacaagctacgcaaggccctctacgcagaatctgtacaacaact
ttatatgatgaaaaattgccaaatatacctcctcttgcgaaagaagatgaggatgtcatc
aatgatctgcttgggtgttctggggaaagattatctccaagttgttatattgaatcaaat
tccgttacttgcgattgttatcctgaggaccataaaagatgtcgagtggtgtacatagat
ttctcctatagtcaattacaaggtgtgatccctgcaaagattggaaaccttcaatattta
aaaacgctatatttgaatggaaacaatttgcgtggatacattcctgaatcattcaaaaag
ctggataatctgtcggaattttctctctgtgataacttattggaaggagccattccacct
ttctttggtcagatgtcgtctgtaaaacaaatatatttgtgcaaaaagttgttcaaccaa
acaattcctccggaattgggtgctctcccatcgttggaatatttagacttgggttataac
ttcttatcagggaaaattccggctgagcggggaaatattaagagcctcattggattgtac
ctctctgataatcaactctcggatgtactcccgggccagcttggaaatcttgtgaatctt
gaggagttgaaattgcagaacaatgaatttattggttcattaccggcgagcttcaagaat
ttgaataaactgacatatttcaatgtgcgagggaacaacctcaatggagcaatcccagat
attttcgagcagtggcaagaccttcgtatcatgaatctgatggggaataatttttctgca
ccattgcatggccaattctcaaagctgaagagtcttaacagaactgcatatcagtactta
attggaggaagctcgtcgtttccagatttatctggaacaaaatttttgagacttttgaca
ttgaggaattgttcaatagctgaccgcatccccgttggactatggaatttacctggccta
cagtatctggacttgagtttcaatagtttgtttggtgcaattccagaagttgttgacaac
tcactggtttatatatatctaagaaaaaataatctcaatgagacaattccagcttggatg
aatgctaattcatacgtggatgtttctgaaaaccttttcagagatgtgagcattaacccc
gggcagacgctaaaccctgacttgaatctgttcaagtgctgctccaacgaaaaggataag
gttgcaaagcaggaccaagttgatttcgattgtaagaatggaactcagttttatgaccgt
ttgtatataaactgcggtggtgagtctgtatcagttaacggaagagtttatgaagctgat
gtaaatccacgtggtgaatcaactttcttcagtagatcaaattggggcaatagtagtatg
ggaagcttcttatgggcaagtcgtaatgagtacattctatatgattgccaaatccaagct
ggtgatgcacaattgtatagctcagcacgtttatccccaatatccttgaaatattatgga
ttttgtttgaaaagtggtgtgtacgacgtgaagcttcactttgctgaaatatctagtagc
gagaataaagtttcgcatagcaaagcaggacgtctgtttgatgtagatatccagggggaa
aatgtgctgagaaacttcaacatagaaaaggacgcgggaggtgtgaatatggctataaca
aaggaatttacttgtgtgctgaataacagtctggagattcacttatactggtctggaaaa
ggatctgtcttataccgatcagagtactatgggccccttatatccgcaattacagtaact
ccagctcgtgaatcaaatctgtccactggagcgcttgctggaatttcagtatttgcatta
cttcttctaactacattattcatagttttttcctggagattcaaagacatatggcaggga
gagctagaacttgttgaattgtaccctggagggctttacaactatcagaaaattaaagct
gccacaaagaattttgatactgcgaaccggattggtgaggggggttttgggacagtctat
aagggcacactttcaaatgggactgccgtcgcagttaaaaagctttcaagaacaaaagaa
ggaatgtgggagtttgtggaaaagagtcgtgcaattgctggcatgaaacatccgaatctt
gtaacactaatgggatgctgtctaggaaacaactaacttctgcttatctatgagtacatt
ggaaccaacactcttgaagatgcattatttggttcagatgaacttagagctagactagat
tggccaacgagatatagaatttgtcttggtctagcagaaggtttagcttttcctcacgag
ggctccaaacaggaaattatacatggggatattaaaccagcaaacattcttcttgatgat
gatctaaatccgaagatatatgattttggatttgcaaggctctatcacaagcaaaagaca
gaaggaacaatgtcatacacagcgccaaaagttaaagatcgccccttagaagtgagcgcg
gatgtgtatagctttggagttgtcacacttataattgtcagaggaatgaaaatcaagaac
ccgaggccaggtggtgagactgaatacctcgtggatgaggcacaaaaaaaggatcagagg
ggaactttaatggaactcgttgatcgtaatctgatgagctatgactgggaagaaacagag
atgattctacaattagcaatccaatgcatagattctccgtcagtcagaccaaccatgtct
aaaatcgtgaagattttaaagaaagaacccttaatcgagaccattttgatcaagccagag
ggtgtttaa

DBGET integrated database retrieval system