KEGG   Capsicum annuum: 107857556Help
Entry
107857556         CDS       T04646                                 

Definition
(RefSeq) UDP-glucuronate 4-epimerase 3-like
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
cann  Capsicum annuum
Pathway
cann00520  Amino sugar and nucleotide sugar metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    107857556
Enzymes [BR:cann01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     107857556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 adh_short NmrA NAD_binding_10 KR Methyltransf_25 Methyltransf_11
Motif
Other DBs
NCBI-GeneID: 107857556
NCBI-ProteinID: XP_016557837
UniProt: A0A2G2YKQ1 A0A1U8FEX6
Position
2
AA seq 430 aa AA seqDB search
MKHIDNIPSTPGKLKEKSPYNRLRLYFSVAKLTFWSFVFLGLIFVCFFRSPSSSSPAGSD
LSRRSLRTSSYDGPAWEKRIKSSAKVRSRNGISVLVTGAAGFVGTHVSAALKRRGDGVVG
LDNFNDYYDPSLKRARQSLLEHAGVYIVEGDINDVTFLKKLFDVAQFSHVMHLAAQAGVR
YAMENPSSYVHSNIAGLVNLLEVCKNANPQPAIVWASSSSVYGMNIKVPFSEMDRTDQPA
SLYAATKKAGEEIAHTYNHIYGLSLTGLRFFTVYGPWGRPDMAYFFFTRDILKGQSISIF
EAANHGTVARDFTYIDDIVKGCLGALDTAEESTGSGGKKKGPAQLRMFNLGNTSPVPVSD
LVSILERLLKVKAKRSVMKLPRNGDVPFTHANISFAQRELGYKPTTDLQTGLKKFVRWYI
SYYGDGKKSA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacattgacaatattccatcaaccccaggaaagttaaaggaaaaatccccttac
aataggctcaggctatatttttctgtagccaagctcacattttggtcatttgtcttcttg
ggcttgatctttgtatgctttttcagatcaccatcctcgtcgtcccctgccggttcagat
ctctcgagacgatctcttagaaccagctcgtatgatggcccagcttgggaaaaaaggatt
aagtcctcagcaaaagtcaggtcaagaaatggtatttctgttttggtgactggtgctgct
ggctttgtaggaacacatgtctcagctgcgttaaaacgtcgtggtgatggcgtagtgggg
ttggataatttcaatgactattacgatccgtctctaaaaagagctcggcaatctctatta
gagcatgcaggggtttacattgtagaaggtgacatcaatgatgtcaccttcttgaagaaa
ttatttgacgttgctcaatttagtcatgtgatgcatttggctgcacaagcgggtgtaagg
tatgccatggaaaatcctagctcatatgtgcatagtaacattgctggcttggttaatctc
cttgaggtttgcaaaaatgctaatcctcaacctgctattgtgtgggcatcatcaagttct
gtttatggaatgaatattaaagtacccttttcggagatggatagaacagaccagcctgct
agtctatatgctgcaactaaaaaagctggtgaggaaattgctcatacctataatcatata
tatgggctttcactaactggattgagatttttcacggtttatggaccatggggtcggcca
gatatggcttacttctttttcacaagggatattttgaagggacagtcaatatccatcttt
gaggcagctaatcatggcactgttgctagggactttacctacattgatgacatagtaaag
ggttgtttgggagcattggacacggctgaagaaagcaccggaagtggtgggaaaaagaaa
ggccctgctcaattgcggatgttcaatttgggcaacacttctcctgtgcctgtttctgat
cttgtcagcattttggaaagattgctaaaggtaaaggctaaaagatcagtgatgaagttg
ccaaggaatggtgatgtgccgtttactcatgcaaacataagctttgcccaaagggaactt
ggatataagcctacaacagatctgcagacaggactgaagaaatttgttcgatggtacatc
agttactatggtgatggaaagaagagtgcctag

DBGET integrated database retrieval system