KEGG   Capsicum annuum: 107858459Help
Entry
107858459         CDS       T04646                                 

Gene name
SCS
Definition
(RefSeq) succinyl-CoA ligase [ADP-forming] subunit alpha-2, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
cann  Capsicum annuum
Pathway
cann00020  Citrate cycle (TCA cycle)
cann00640  Propanoate metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107858459 (SCS)
   00640 Propanoate metabolism
    107858459 (SCS)
Enzymes [BR:cann01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     107858459 (SCS)
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     107858459 (SCS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 107858459
NCBI-ProteinID: NP_001311675
UniProt: K4FZR6 A0A1U8FS71
Position
2
AA seq 326 aa AA seqDB search
MARQATRVISKWSTKLNPNEYRYFGSSAPPPAVFVDKNTRVICQGITGKNGTFHTEQAIE
YGTKMVGGVTPKKGGTEHLGLPVFNTVAEAKAETKANASVVYVPPPFAAAAIMEAMEAEL
DLVVCITEGIPQHDMVRVKAALKKQSRTRLIGPNCPGIIKPGECKIGIMPGYIHKPGRIG
IVSRSGTLTYEAVFQTTAVGLGQSTCVGIGGDPFNGTNFVDCLERFIADPQTEGIVLIGE
IGGTAEEDAAALIKESGTQKPVVAFIAGLTAPPGRRMGHAGAIVSGGKGTAQDKIKALKE
AGVTVCESPAKIGITMLDVFKQRGLA
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggctcgtcaagcgacaagagtgatctcaaagtggagtacaaagcttaaccctaatgag
tatcgctactttggatcgtcagcaccaccgcccgctgttttcgttgataagaacacccgc
gtcatctgtcaaggcatcaccggcaaaaacggcactttccacactgaacaagccattgaa
tacggtactaaaatggttggtggagtgacccccaagaagggtggaacagaacatttgggg
cttcctgttttcaatactgttgcagaggcaaaagcagagacaaaggctaatgcttcagtg
gtttatgtccctccaccatttgctgcagcagctattatggaggccatggaagctgagttg
gacttagttgtctgcataacggagggaattcctcagcatgatatggttcgcgtaaaagct
gctcttaagaagcaatcaagaactcggctgattgggccaaattgtccaggtattatcaaa
ccaggagagtgcaaaattggaattatgcctggatacattcacaaacctgggcgtattgga
attgtttctcgatctggtacattgacatatgaagcagtttttcagacaactgctgttggt
cttggacagtcaacttgtgtagggattggtggtgatccttttaatggtacaaattttgtc
gattgcttagagagatttattgctgatccacagacagaaggtattgttcttattggtgag
atcggtggtacagcagaagaagatgctgcagccttgataaaggaaagtggaactcaaaag
cctgttgttgcatttattgctggactaactgctcctcctggacgacgaatgggtcatgct
ggagccattgtatcgggtggaaagggaacagcacaggacaagatcaaggctctcaaggaa
gctggggttacagtatgcgagtctcctgctaaaattgggatcacaatgcttgatgtgttc
aaacagaggggtcttgcgtaa

DBGET integrated database retrieval system