KEGG   Capsicum annuum: 107860862Help
Entry
107860862         CDS       T04646                                 

Definition
(RefSeq) vacuolar-processing enzyme-like
  KO
K01369  legumain [EC:3.4.22.34]
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:cann01002]
    107860862
Enzymes [BR:cann01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     107860862
Peptidases and inhibitors [BR:cann01002]
 Cysteine peptidases
  Family C13: legumain family
   107860862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C13 Peptidase_C14 DUF483
Motif
Other DBs
NCBI-GeneID: 107860862
NCBI-ProteinID: XP_016561825
UniProt: A0A1U8FSP3
Position
2
AA seq 461 aa AA seqDB search
MIFTYNICIVLLVVLSIWASIEGRSISRFLTDETVGTKWAVLVAGSHGWWNYRHQADVCH
AYQILKKGGLKDENIIVFMYDDIANNTMNPRPGVIINNPHGQNVYKGVPKDYVGKDVCAD
NFFNVILANKSGITGGSGKVLKSGPNDHIFIYYVDHGGPGILSMPTGFMYAKDLTDVLKK
KHASGTYNKLVFYLESCESGSMFDGLLPKGLNIYVTTASKPNEDSWGTYCGQVSASDPCL
VECSPPEFKGLCLGDLYSVAWMEDSEAQDRRTETLGDQYNVIAKRTAANLAYGSHVMQYG
DTGISVDALFQYMGAASVNHSYVSMNFKSSSQNVNQRDAELFHLKSKYEDAPEGSDEHFK
TRAELTKTMAHRSQVDRSIEHLAELLFGAEKGNELLKTVRPAGQPLVDNWDCLKFYVKTF
EAQCGKLTSYGKKHIRGIANICNAGIESEQMTAATAQACPI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgatatttacgtacaatatctgtattgtgcttcttgttgttctctcaatttgggccagc
attgaaggtcgtagtatttctagattcttaactgatgaaacagtagggacaaaatgggct
gtcctagttgctggctctcatggatggtggaattataggcaccaggctgacgtatgtcac
gcttatcaaatactaaagaaagggggtcttaaagatgaaaacattattgtattcatgtac
gatgatattgctaacaatacaatgaatcctagacctggggttatcatcaataatccacat
ggccaaaatgtttacaaaggtgtccccaaggattatgtaggtaaagatgtttgtgctgat
aattttttcaatgttattcttgcgaacaaaagtggtatcactggaggaagtgggaaagtt
ttgaagagtggtccaaatgatcatatcttcatctactatgttgatcatggtggccctggt
attctttcaatgccaactggatttatgtacgcaaaggatctgactgatgtgttgaaaaag
aagcatgcttctgggacatataataaactggtattttatttggaatcgtgtgagtccggg
agcatgtttgacggtcttcttcctaaaggtctaaatatttatgtaactactgcatcaaaa
cctaatgaagatagttggggaacatactgtggtcaagttagtgccagtgatccttgctta
gttgagtgttcccctccagaatttaagggtttgtgtttgggagacttatatagtgttgct
tggatggaagacagtgaggcccaagatcgacgaactgaaactttgggtgaccagtataac
gtgattgcaaagagaactgcagccaatctagcatatggctcgcatgtcatgcaatatggt
gatacggggataagtgtcgatgctctttttcagtatatgggtgctgcttcagtgaaccat
agctatgtttccatgaattttaaatcatcgtcacagaatgttaaccagcgtgacgctgaa
cttttccacctgaaatcaaaatatgaagatgctcctgaaggctctgatgagcattttaaa
actcgtgccgaacttactaaaactatggcacatagaagtcaagtggaccgtagtatcgaa
catcttgccgagcttttgtttggagcagaaaaaggtaatgagttactgaaaaccgttcga
cctgctggacaacctctagttgacaattgggattgcctaaaattctatgtcaaaacattt
gaggcacaatgtggaaaattaacctcatatggaaagaaacatatacgtggtatcgcaaac
atttgcaatgctggaattgagagtgagcaaatgactgctgcaacagcacaagcatgtccc
atttaa

DBGET integrated database retrieval system