KEGG   Capsicum annuum: 107861043Help
Entry
107861043         CDS       T04646                                 

Definition
(RefSeq) putative cysteine-rich receptor-like protein kinase 43
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cann01001]
    107861043
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107861043
Protein kinases [BR:cann01001]
 Serine/threonine kinases: TKL group
  IRAK family
   107861043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Stress-antifung Pkinase_fungal APH TMEM154
Motif
Other DBs
NCBI-GeneID: 107861043
NCBI-ProteinID: XP_016561929
UniProt: A0A1U8G1R8
Position
2
AA seq 659 aa AA seqDB search
MANVIILLLLIFFIVPTVIGNPRTELVYKFCGEEHAVNASVFNQNYANAIVAMKPEMKSN
KFSSYGEGFAPNRIFVLAQCMDDLSKEDCEICFSTINAQLPGCFPHISGRVFFDGCFMRF
ENYSFFYESSSPHDVKRCSDAVNLQNDQFRDVATKVVKDVAAMAPGHTGYAEGRSKAYGL
SFYGMAICWNTLDEESCSDCLSNASRAVLECLPSIEARSLSVGCYLRYSQYESKDGSNFV
LNTKGGLVMYLVFILVAVGVCIAAVLVGYIVGTTLHEKRVKRQKKNNVHSSDLESSAIKR
SLHFNYSTLEKSTDNFSEELKIGQGGFGEVFKGTLPDGREIAIKRMFLTTKIRNEEVSNE
IDIIGLAQHQNLVRLLGCCFNDDDSFLVYEYLENKSLDLILFDPKKKKDLDWKKRLRIIE
GTAEGLECLHNDCQVRIIHRDIKPSNILLDAKYRPKIADFGLARFNIREKVAAPLVIAGT
FGYMAPEYLAQGQLTDKVDVYSFGVLILEIVSGREINKISADDTLDTLVTIAWKYFKEKR
ASRIIDPSMEIQDVDEVLRVVQIALLCTQESPIMRPDMTTVIKLLTQEKLEVPVPSKPPF
IVDSFHGSKRNDSIHRHHPCTSSVDSCRYYDTHQDNGSFHRHHPSSSIDSYYDTESVLG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggccaatgtcattattttattactgttaatctttttcattgttccaacagtcattggt
aatcctcgtacagaacttgtctataaattttgtggggaggaacatgctgtgaatgcttca
gtattcaaccaaaattatgctaatgcaattgtagcaatgaagcccgaaatgaaatcgaat
aaattttctagttatggtgaagggttcgctcctaatagaatttttgtattggctcaatgc
atggatgatttatctaaggaagattgtgagatttgtttttctaccattaacgcacagttg
cctggttgttttcctcatataagtggacgtgttttctttgatggatgtttcatgagattc
gagaattatagcttcttttatgaatcttcttctccacatgacgttaaaagatgcagtgat
gcagtgaacctgcagaatgatcaatttagggatgtggctaccaaagtcgttaaggatgtg
gcagccatggccccaggtcacactggctatgcagaaggacgaagcaaagcatatggttta
tcattttatggcatggctatctgctggaatactttggacgaagaatcatgttctgattgc
ctatcaaatgcaagcagagctgttcttgaatgtttgccatccattgaggcgcgctccctt
agcgttggctgctatttacgttattcacagtatgaatctaaggatggttcaaatttcgtt
cttaatactaaaggaggtcttgtcatgtaccttgtatttattcttgttgctgttggtgta
tgcatagctgctgttctggttggatatattgtgggcacaactctccatgaaaaacgagtg
aaacgccagaagaaaaataatgtccattcatcggatcttgagtcatctgctataaaaagg
agcctgcatttcaactattcaacattagagaaatccacggacaatttcagtgaagaactc
aagattggccaaggtggatttggtgaagtctttaaaggaactttgccagatggtagagaa
attgctatcaaacgaatgtttttaactaccaaaattcggaatgaagaggtatcgaatgag
atagacattattggactagcccaacaccagaatttggtccgtttacttggttgctgtttc
aatgatgatgacagctttcttgtctatgagtatttggaaaataaaagccttgatcttatc
ttattcgatccaaagaagaagaaagacttggattggaagaaaaggctcaggataatcgaa
gggacagctgaaggtttagaatgccttcataatgattgccaagttcgaatcattcacaga
gacattaaacctagtaacatcttactagacgcgaaataccgtcccaaaattgcagatttt
ggtcttgccaggtttaatatcagggaaaaagtagctgcacctcttgtcattgcaggcaca
ttcggatacatggctccagagtaccttgctcaaggacaattaacagacaaagtggatgtt
tatagctttggagtccttatcctagagatagtaagtggccgggagattaacaaaatttcg
gccgatgacactctagacacccttgtaactattgcctggaaatatttcaaggagaaaagg
gcatctcggataatagatccgagcatggagatacaagatgtggatgaagtactaagggtg
gttcaaattgccctactatgtactcaagagtcacctattatgcgtccagatatgacgaca
gttattaaactacttacacaagaaaaactagaagtgccagttccatcaaagcctcctttc
atcgtggattcatttcatggttctaaacgaaatgactctattcatcggcatcatccttgt
acatcatcagttgattcttgcagatattatgatacacatcaagataatggctcttttcat
cggcatcatccttcttcatcgattgattcttattatgacacggaaagtgttttaggatga

DBGET integrated database retrieval system