KEGG   Capsicum annuum: 107862051Help
Entry
107862051         CDS       T04646                                 

Gene name
HSP70-1
Definition
(RefSeq) heat shock 70 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
cann  Capsicum annuum
Pathway
cann03040  Spliceosome
cann04141  Protein processing in endoplasmic reticulum
cann04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    107862051 (HSP70-1)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107862051 (HSP70-1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    107862051 (HSP70-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cann01009]
    107862051 (HSP70-1)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cann03041]
    107862051 (HSP70-1)
   03009 Ribosome biogenesis [BR:cann03009]
    107862051 (HSP70-1)
   03110 Chaperones and folding catalysts [BR:cann03110]
    107862051 (HSP70-1)
   04131 Membrane trafficking [BR:cann04131]
    107862051 (HSP70-1)
   03051 Proteasome [BR:cann03051]
    107862051 (HSP70-1)
   03029 Mitochondrial biogenesis [BR:cann03029]
    107862051 (HSP70-1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cann04147]
    107862051 (HSP70-1)
Protein phosphatases and associated proteins [BR:cann01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     107862051 (HSP70-1)
Spliceosome [BR:cann03041]
 Complex B
  Other components
   Prp19 complex
    107862051 (HSP70-1)
 Complex C
   Prp19-CDC5 complex
    107862051 (HSP70-1)
Ribosome biogenesis [BR:cann03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    107862051 (HSP70-1)
Chaperones and folding catalysts [BR:cann03110]
 Heat shock proteins
  HSP70 / DNAK
   107862051 (HSP70-1)
Membrane trafficking [BR:cann04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    107862051 (HSP70-1)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    107862051 (HSP70-1)
Proteasome [BR:cann03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    107862051 (HSP70-1)
Mitochondrial biogenesis [BR:cann03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    107862051 (HSP70-1)
Exosome [BR:cann04147]
 Exosomal proteins
  Proteins found in most exosomes
   107862051 (HSP70-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C Radial_spoke_3 Hydantoinase_A
Motif
Other DBs
NCBI-GeneID: 107862051
NCBI-ProteinID: NP_001311758
UniProt: V5K655
Position
3
AA seq 652 aa AA seqDB search
MAKAEGKSIGIDLGTTYSCVGVWQNDRVEIIPNDQGNRTTPSYVAFTDTERLIGDAAKNQ
VAMNPQNTVFDAKRLIGRRFSDPSVQSDMRHWPFKVVAGQGDKPMIVVQYKGEEKQFSPE
EISSMALVKMKEVAESFLGSTVKNAVVTVPAYFNDSQRQATKDAGAISGLNVMRIINEPT
AAAIAYGLDKKAASTGEKNVLIFDLGGGTFDVSLLTIEEGIFEVKSTAGDTHLGGEDFDN
RLVNHFAQEFKRKHKKDISGNPRALRRLRTACERAKRTLSSTAQTTIEIDPLYEGIDFYA
TITRARFEEMNMDLFRKCMEPVEKCLKDAKIDKGHVHDVVLVGGSTRIPKVQQLLQDFFN
GKELCKSINPDEAVAYGAAVQAAILSGEGDQKVQDLLLLDVTPLSLGIETAGGVMTVLIP
RNTTIPTKKEQIFSTYQDNQPGVLVQVFEGERPMTKDNNLLGKFELKGIPPAPRGVPQVN
VCFDIDANGILNVSAEDKTAGVKNKITITNDKGRLSKEEIERMVQEAEKYKAEDESMKKK
VEAKNSLENYAYNMRNTVKDEKFSGKLDPSDKQKIEKAVDETIEWLDGNQLAEVDEFEDK
LKELENLCNPIIAKMYQGGAGGDVPMGADSGAGYGQGGSADNGPGPKIEEVD
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagctgaaggcaaatcaattggcattgatctcggcacgacctacagttgtgtt
ggggtttggcaaaatgatcgtgttgaaatcatcccaaatgatcaaggcaacaggacgact
ccatcctacgttgctttcacagatacagagcgtctcatcggcgatgcagccaagaatcag
gttgcaatgaacccccagaacaccgttttcgatgctaaacgtttgatcggtcgaagattc
tccgacccctctgtccaaagtgacatgaggcactggccgttcaaggtggttgccggtcaa
ggtgacaagcccatgatcgttgttcagtacaagggggaggagaagcagttctctcctgag
gagatttcgtcaatggctttggttaaaatgaaggaggtggcggaatctttcttggggagt
actgtaaagaatgctgtggttactgtacctgcttatttcaatgattctcaaaggcaggct
actaaagatgcaggggctattagtggtctaaatgtgatgaggattattaatgagcctact
gctgctgcaattgcttatggtttggataagaaggccgcgagtactggcgaaaagaatgtg
ttgatctttgatcttggcggtggaacttttgacgtttcgctgttgactattgaggaaggg
atttttgaagtgaagtctactgctggggatacacatttgggtggtgaagattttgacaat
agacttgtcaatcactttgcacaggagtttaagaggaagcataagaaggatattagtggc
aacccaagggcgctgaggcgattgagaaccgcctgtgagagggcgaagaggacactgtca
tcaactgctcagacaactattgagattgatcccttgtatgaagggatcgatttctatgct
acgataaccagggcgagatttgaagagatgaacatggatcttttcaggaagtgtatggaa
cctgtggagaaatgtttaaaggatgccaagattgacaagggtcatgttcatgatgtggtt
cttgttggtggttccactaggatcccaaaagtacagcagctgttgcaagattttttcaat
gggaaggagctttgcaagagtattaatcctgatgaggccgtggcttatggtgctgctgtt
caagctgcaattttgagcggagaaggtgaccagaaagttcaagatttgctgcttcttgat
gtcacacctctcagtcttggtattgagactgctggtggagtgatgacagtgttgattcca
agaaacactacaattccaacaaagaaagaacagatcttttcgacctaccaggacaatcaa
ccaggtgtgctagttcaggtgtttgagggagagaggcctatgactaaagacaacaacctt
cttggaaagtttgagctgaagggtattcccccagcaccaagaggagtgcctcaggtcaat
gtctgtttcgacattgatgccaacggtatcctcaacgtgtcagctgaggacaagactgct
ggtgtgaagaacaagatcacaattacaaatgacaaaggaaggttaagcaaggaagaaatt
gagaggatggttcaagaagcagagaagtacaaggcagaggatgagtccatgaagaaaaag
gtcgaggcgaagaactcactggagaattatgcttacaacatgaggaatacagtgaaggat
gagaaattctcagggaaattggatccgtccgacaagcagaagatcgagaaggctgtggat
gagacgattgagtggttggatgggaaccaattggctgaagtagatgaatttgaggacaaa
ttgaaggagttggagaacttgtgcaatccaataattgcaaagatgtaccaaggtggtgct
ggtggagatgtgcccatgggagctgatagtggagcaggttatggccaaggaggatctgca
gataatggtccaggccctaaaattgaagaagtggattaa

DBGET integrated database retrieval system