KEGG   Capsicum annuum: 107862118Help
Entry
107862118         CDS       T04646                                 

Definition
(RefSeq) magnesium protoporphyrin IX methyltransferase, chloroplastic
  KO
K03428  magnesium-protoporphyrin O-methyltransferase [EC:2.1.1.11]
Organism
cann  Capsicum annuum
Pathway
cann00860  Porphyrin and chlorophyll metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107862118
Enzymes [BR:cann01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.11  magnesium protoporphyrin IX methyltransferase
     107862118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mg-por_mtran_C Methyltransf_25 Methyltransf_23 Methyltransf_12 Methyltransf_31 Methyltransf_11 MTS PrmA Methyltransf_18 Ubie_methyltran Methyltransf_32 CMAS TehB Methyltransf_9 tRNA_U5-meth_tr
Motif
Other DBs
NCBI-GeneID: 107862118
NCBI-ProteinID: XP_016563058
UniProt: A0A1U8G303 A0A2G3A2V2
Position
3
AA seq 315 aa AA seqDB search
MAFCSPLFSPVNFAVVPKHTKPNYRRNFTISAIPPLSTAITSPLDGTTLAVLGGSSVAAL
AAILSLTDPERRRQLQAEEVGGGDKEVVREYFNNNGFDRWKKIYGDTDDVNKVQLDIRLG
HSKTVENVMKMLTEEGSLKGVTVCDAGCGTGCLSIPLAKEGAIVSASDISASMVAEAQKQ
AQEELLKAKDDLAPTPVMPKFEVKDLESLDGKYDTVVCLDVMIHYPQSKADGMIAHLASL
AENRLILSFAPKTFYYDLLKRIGELFPGPSKATRAYLHAEADVEKALQKAGWKIRKRGLI
ATQFYFAKLIEAVPA
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggctttctgttcgccgttattttctccggttaacttcgccgttgttcccaaacacaca
aagccaaactaccgccgtaacttcaccatctccgccattccaccgctctccaccgccatc
acttctccattagacggcacgactctcgccgtactcggcggcagttcggtagcagcactt
gcagctattctctcgctcaccgaccccgagaggcggcggcagcttcaggcggaggaagta
ggcggcggtgataaggaggtagtgagagagtattttaataataatggatttgataggtgg
aagaagatatatggtgatacggatgatgtgaataaagtgcagttggatattagattggga
cattcgaaaactgttgagaatgttatgaaaatgttgactgaagaaggatctttaaaggga
gttactgtgtgtgacgctggttgtgggacgggttgtttgtccattccgttagctaaagaa
ggtgctattgtatctgctagtgatatttcagcttccatggttgctgaagcacaaaaacag
gctcaagaggagttgttgaaggctaaggatgatctggctccgacaccagtaatgccaaaa
tttgaagtgaaggacttggagagtttggatgggaagtatgacactgtggtctgcttagat
gttatgatacattacccgcaaagtaaggctgatggtatgattgctcatcttgcatcattg
gctgagaatcgtttgatcctgagctttgccccgaagacattctactatgatttgttaaaa
agaatcggagagttgttccctggaccttcaaaggctacacgagcatatctacatgcagag
gctgatgtggagaaggcgctgcagaaagctgggtggaagataaggaagagaggcttgatt
gctactcaattttattttgctaagcttattgaggctgtccctgcttag

DBGET integrated database retrieval system