KEGG   Capsicum annuum: 107862384Help
Entry
107862384         CDS       T04646                                 

Definition
(RefSeq) DEAD-box ATP-dependent RNA helicase 51-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:cann03041]
    107862384
   03009 Ribosome biogenesis [BR:cann03009]
    107862384
Enzymes [BR:cann01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     107862384
Spliceosome [BR:cann03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    107862384
Ribosome biogenesis [BR:cann03009]
 Eukaryotic type
  90S particles
   Helicases
    107862384
  Pre-60S particles
    107862384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII AAA_22 FAM176 CDC45
Motif
Other DBs
NCBI-GeneID: 107862384
NCBI-ProteinID: XP_016563437
UniProt: A0A1U8G416 A0A1U8FW92
Position
3
AA seq 574 aa AA seqDB search
MLSAMVEVEENPNIVVAEEESIKKKRKRKRDKRNKMVVEKETKKEKENEDEEDERQEDDE
EQKKLDDELKAEIKKEMKSGLGIMSAELFSSVEISEPTMKAIKDMGFEYMTQIQARAIPP
LLEGKDVLGAARTGSGKTLAFLIPAVELLFHVHFTPRNGTGVVVICPTRELAIQTHAVAK
DLLKYHSQTLGLVIGGSARRAEAERIAKGANLLVCTPGRLLDHLRNTKGFIYKNLKCLVI
DEADRILEANFEEDMQQILKLLPKEGRQTALFSATQTKKVEDLARLSLTAPIYIDVDDGR
RRVTNEGLQQGYCVVPSARRFILLYSFLKRNLSKKIMVFFSSCNSVKFHSELLRYIKIEC
YDIHGKQKQQKRTSTFFDFCDAKKGILLCTDVAARGLDIPAVDWIVQFDPPDEPKEYIHR
VGRTARGEGAKGNALLFLIPEELQFLKYLKAAKVPVKEYEFDQKKLANVQSLLEKLVANN
YYLNQSAKEAYRSYLLSYNSHSMKEIFNVHRLDLQAVASSFCFSNPPKVHLNIDSNASKF
RQKKRKVEGSRNGFSEKNPYGKKGGDDTKQFVRY
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcagccatggttgaggttgaagaaaaccctaatatagtagtcgcagaagaagag
tcaattaagaagaagagaaagcgaaagagagacaagaggaacaaaatggttgtggaaaag
gagactaagaaggagaaagagaacgaggacgaagaagacgagaggcaagaggatgatgaa
gaacagaagaaattggatgatgaactgaaggcggagattaagaaagagatgaagagtgga
ttaggtattatgagtgcggagttgttttcctctgttgaaatttctgaacccaccatgaag
gcaatcaaggatatgggatttgagtacatgactcagatccaagccagggcgattcctcct
cttctggaaggcaaggatgttctcggagctgcaagaactggttccggtaaaacattagca
tttttgattccagctgtggagttattatttcacgtccactttacacctcgtaatggaact
ggggtggttgttatttgcccaacaagagaactggctatacagacgcatgctgtggcaaag
gatcttctcaagtatcactcacagactctcgggttggttattggtggttcagcaagaaga
gcagaggcagaacgtattgcaaaaggggctaatctcttagtatgcacccctggccgactt
cttgatcatcttagaaataccaagggtttcatttataagaaccttaagtgtcttgtgatt
gatgaagctgataggattttggaagcaaactttgaggaagacatgcagcaaatcctcaaa
cttctaccaaaggaggggaggcagactgctctcttttcggccacacagacaaaaaaggtt
gaagaccttgcacgcttatctttgacagctcctatctacattgatgtggacgatgggagg
aggagggtcacgaacgaagggctacaacaaggatactgcgttgtcccaagtgccaggaga
tttattctcctttattcattcttgaagaggaacctgtcaaagaaaataatggttttcttc
tcatcttgcaactctgtcaagttccattctgaacttcttcgctatatcaagattgaatgc
tatgatattcacgggaagcaaaagcaacaaaaacgaacatctaccttttttgatttttgc
gatgcaaagaagggcatcctgttgtgtacggatgtcgccgcacgtggtctggatattcct
gctgtggactggattgtgcagtttgatccccctgatgaacccaaggaatacatacacaga
gttggtcgaacagcacgtggtgaaggtgctaaaggaaatgccttactcttcttgattcca
gaggagttgcagtttctcaagtacctgaaggcggcaaaagtgcctgtaaaagagtatgaa
tttgatcaaaagaagctggccaatgttcagtcactcctggaaaaattggtcgcaaacaac
tattacttgaaccagtcagctaaggaggcatataggtcctatttactatcatataattct
cattccatgaaggaaatattcaatgttcaccgacttgatctgcaggctgtagcttcttcc
ttttgtttttctaatcctccaaaagtacaccttaacatagatagcaatgcatccaagttc
aggcagaaaaagcgtaaagttgaaggaagccgaaatgggttcagtgagaaaaatccctat
ggaaagaaaggaggtgacgatacgaagcagtttgtaagatattag

DBGET integrated database retrieval system