KEGG   Capsicum annuum: 107863035Help
Entry
107863035         CDS       T04646                                 

Definition
(RefSeq) glutamate-1-semialdehyde 2,1-aminomutase, chloroplastic
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
cann  Capsicum annuum
Pathway
cann00860  Porphyrin and chlorophyll metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Module
cann_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107863035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cann01007]
    107863035
Enzymes [BR:cann01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     107863035
Amino acid related enzymes [BR:cann01007]
 Aminotransferase (transaminase)
  Class III
   107863035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 107863035
NCBI-ProteinID: XP_016564271
UniProt: A0A1U8FYQ4
Position
3
AA seq 478 aa AA seqDB search
MAAVTSVGLSWPSKLTKTQKPKWGLSSSHSSSVAAAATIRMTASVDEKKKTYTLQKSEEA
FNKAKELMPGGVNSPVRAFKSVGGQPIIIDSVKGSRMRDIDGNEYIDYVGSWGPAIIGHA
DDEVLAALAETMKKGTSYGAPCLLENTLAEMVISAVPSIEMVRFVNSGTEACMGVLRLAR
AFTGRTNIIKFEGCYHGHADPFLVKAGSGVATLGLPDSPGVPNAATSDTLTAPYNDISAV
ESLFAEHKGEIAALILEPVVGNAGFIPPKQEFLAAIRKITKENGALLIFDEVMTGFRLAY
GGAQEYFGITPDLTTLGKIIGGGLPVGAYGGRREIMEMVAPAGPMYQAGTLSGNPLAMTA
GIHTLKRLQGPGTYEHLDKITGELTQGILDAGKKTGHAMCGGYIRGMFGFFFTDGPVLNF
SDAKKSDTEKFGRFYRGMLEEGVYFAPSQFEAGFTSLAHTPVDIERTIAAAEKVLKQI
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcagctgtaacaagtgtaggactttcatggccatcaaaattgactaaaactcaaaaa
cccaaatggggtttatcttcatctcattcttcttctgttgctgctgctgcaacaattaga
atgactgcttcagttgatgaaaagaagaaaacttacacacttcaaaaatctgaagaagct
ttcaacaaagccaaggagttgatgccaggaggtgtaaattcccctgttcgtgcttttaag
tcagttggcggacaacctatcattattgattcggtgaagggctctcgtatgcgggacata
gatggtaacgagtacattgactatgtcggatcatggggtccagctataatcggccatgca
gatgatgaggtgctagcagccttggctgaaacaatgaagaaaggaacgagctacggtgct
ccatgtctccttgaaaatacactggcagagatggttatttcagctgttccaagcatagaa
atggttcgatttgtcaactctggtacagaagcatgtatgggagtactacgactggctcgt
gctttcactggtcgaactaacatcatcaaatttgagggttgttaccatggtcatgctgat
ccatttcttgttaaagcgggcagtggggttgccaccctaggtctccccgactccccggga
gttccaaatgcagctacttccgatactctgacagcaccttacaatgatatttctgctgtg
gaaagcctctttgcagagcacaaaggagaaatagctgctctaattctcgaacctgtagtc
ggaaatgccggcttcatcccacccaagcaagaatttcttgctgccattcgcaagatcacc
aaagagaatggtgcactccttattttcgacgaagttatgactggatttaggttggcatat
ggcggagctcaagagtatttcggaataactccagatttgacaacactcgggaagattatt
ggtggtggcttgccagtaggtgcatacggaggaaggcgggagattatggagatggtagca
cctgcaggaccaatgtatcaagctggcaccctaagtgggaacccattggccatgactgct
ggaattcatacgcttaagcgattacagggaccaggcacatacgaacacttggacaagatc
acaggtgaacttacacaaggaatcttggatgctggaaagaagacaggtcatgccatgtgt
ggcgggtacataagggggatgtttggcttcttcttcacggatggtcccgtccttaacttt
tcggatgcaaagaagagtgatacagaaaaatttggcagattctataggggtatgctggag
gaaggtgtttactttgcaccatcacagtttgaagctggatttactagcttagcacacact
ccagtggatattgaaaggactatagctgcagctgaaaaagttctaaagcaaatttaa

DBGET integrated database retrieval system