KEGG   Capsicum annuum: 107863838Help
Entry
107863838         CDS       T04646                                 

Definition
(RefSeq) uncharacterized LOC107863838
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
cann  Capsicum annuum
Pathway
cann00020  Citrate cycle (TCA cycle)
cann00480  Glutathione metabolism
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01200  Carbon metabolism
cann01210  2-Oxocarboxylic acid metabolism
cann01230  Biosynthesis of amino acids
cann04146  Peroxisome
Module
cann_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    107863838
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    107863838
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    107863838
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     107863838
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh DUF4976
Motif
Other DBs
NCBI-GeneID: 107863838
NCBI-ProteinID: XP_016565485
UniProt: A0A1U8G2V3
Position
3
AA seq 508 aa AA seqDB search
MHFQLYPRTLRKPEDMVSATKKEKHNGVSANQWELGKFFDNKDQKQFFDFKYGCIRFQGL
KNTINSRTCDVCSRAAWKEVLSWQAHSDTIISAVMTLCDLWFDFKSDTIIWGKICPCEGA
EKLLFLIINERPILIAWDVIGNKKVMMLRMRMYDYMMYLVNCHIATHLRVINYQFSSYHF
TLENNGDLDGKGCTQFPILQFSAPSLGKMSSTSFEQNMENGGKQLFMLFQSLGPSFDKKG
PTVEGAASSGWNGRPFAVIKILGQTQKYGENGFNFGQAGDEMTRVIWKLIKDKLILPFVE
LDIKYFVLGLHRRDATDDKVTIESAKATLKYNVAIKCATITPDEARMKEVNLKHVWKRPY
GINRNILNGTVFREPILCKNIPRLVPGWSKPICIGRYAFADQYRATDTVIQRAGKLKLVF
VPEGTDQKIELEVCNFTGAGGVALSMYNTDESIRSFAEASMNMAYQKKWPLYLSTTNTIL
EKYDGRFKDIFHEVYESNWKLKFEEAGI
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgcatttccagttatatcctcgaactctaagaaaaccggaggatatggtttcagctact
aaaaaagagaagcataatggagttagtgcaaaccaatgggaattgggtaagtttttcgat
aataaagaccagaaacaattctttgatttcaaatatggttgtattaggttccaggggttg
aaaaacacaatcaacagtagaacttgtgatgtttgttcaagagctgcttggaaagaagtg
ctctcatggcaggctcattctgatacaattatttccgcggtcatgactttgtgtgactta
tggtttgactttaagagtgatacgataatttggggcaaaatttgcccatgtgaaggagct
gagaaattgctctttctaataataaatgaaagaccaatattaattgcatgggatgtgatt
ggaaacaagaaagtaatgatgttgaggatgagaatgtatgactatatgatgtaccttgta
aactgtcacattgctacacacttaagagtcatcaattatcaattctctagttaccatttc
actcttgagaacaatggtgatctcgacgggaagggatgcactcagtttccaattttacaa
ttttctgcgccttcacttggaaagatgagttcgacatcttttgagcagaatatggagaac
ggagggaagcagttgtttatgttattccagtctcttggtccttcattcgataagaagggt
ccgacagtagaaggagctgcatcttctgggtggaatggacgaccttttgcagtcatcaaa
attttgggacagacacaaaaatatggtgaaaatggttttaactttggtcaagcaggagat
gaaatgacccgtgtcatttggaaattaatcaaggataagctcatcttgccctttgtggag
ttggatataaaatacttcgttcttggcctccatcgccgtgatgccacagatgataaggtt
acaattgaaagtgctaaggctactttgaagtataatgtagcaattaagtgtgcaaccatc
actccagatgaagctcgtatgaaggaggttaacttgaagcatgtgtggaagagaccatat
gggataaataggaatattctaaatggtacggtattcagggaaccaatcctctgcaaaaac
atccctcgacttgtcccaggttggtcaaaaccgatatgcataggcagatatgcttttgct
gatcaatatcgagctactgatacagtaattcaaagagctggaaaactcaaattagtattt
gtaccagaagggacggatcaaaagatcgagttagaggtttgcaacttcactggtgctggt
ggagtagctctatccatgtacaacacggatgagtctattcgttcttttgctgaagcttct
atgaacatggcttaccaaaagaaatggccactctatcttagcacaacgaataccatcctt
gagaaatacgacggaagattcaaggacatattccacgaagtttatgagtcaaactggaag
ttgaagtttgaagaagctgggatctga

DBGET integrated database retrieval system