KEGG   Capsicum annuum: 107864097Help
Entry
107864097         CDS       T04646                                 

Definition
(RefSeq) probable serine/threonine-protein kinase WNK9
  KO
K08867  WNK lysine deficient protein kinase [EC:2.7.11.1]
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cann01001]
    107864097
   01009 Protein phosphatases and associated proteins [BR:cann01009]
    107864097
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107864097
Protein kinases [BR:cann01001]
 Serine/threonine kinases: Other
  Wnk family
   107864097
Protein phosphatases and associated proteins [BR:cann01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107864097
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr OSR1_C Nitrophorin Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 107864097
NCBI-ProteinID: XP_016565846
UniProt: A0A1U8G3A2
Position
3
AA seq 731 aa AA seqDB search
MNGVIDFELDDSEFVEVDPTGRYGRYNEILGKGSSKTVYKAFDEYEGIEVAWNQVKLYDF
MQSPEDLERLYCEIHLLKTLKHKNIMKFYTSWVDVANRNINFVTEMFTSGTLRQYRLKHK
KVNIRAVKRWCRQILKGLHYLHSHDPPVIHRDLKCDNIFINGNQGEVKIGDLGLAAILRK
SHAARCVGTPEFMAPEVYAEEYNELVDIYSFGMCILEMVTFEYPYSECTHPAQIYKKVTS
GKKPDSLYKVTDPEVRRFVEKCLATVSHRLSARELLDDPFLQVDDYVSDSDTPNYLQDSD
ELDPTLGHRPSSICDNNSLVNGCLGYLGYEPEDDSYYHQLEYEANEIDLFTDNEEDDMEN
IDISIKGRRKDDDGIFLRLRIADKEGRVRNIYFPFDIENDTALTVATEMVAELDITEQDV
TKIADMIDGEIALLVPEWKRGFVIEESPDYMNRGCCHKCASNGSLVNYLSSNSPAPPRNL
QVLHCSKHGCGAMHGRFEEITYHFDGSEQCLTDRAPEGSLESDGVHYTDIWAQVDKTKSR
PRGSVDYHSDVKDKSVNESTYGCEEKPISVDKHDKSHPSLQDSHSSTSSGARTPVEDNEN
EIRRELRWLKAKYQMQLRGLKDQQLGVVPKYSRQRLSNKIPRNDKVLSDSTPSIENDHLL
LQSFTSGKNFSSDIPIEIENECSNSKVRRYPLAYGSCSPEHMVTAQSFYTGALLPNSLHR
ATSLPVDAIDC
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgtcattgactttgagttagatgattctgagtttgttgaagttgatcccact
ggaagatatggaaggtacaatgaaattcttggtaaagggtcatcaaagacagtatataaa
gcttttgatgagtatgaagggattgaagtagcatggaatcaggtgaaactttatgacttt
atgcaaagtcctgaagatcttgagaggctgtattgtgaaattcatctgctcaagacattg
aagcataaaaacatcatgaaattctacacttcttgggttgatgttgccaataggaacatt
aactttgtcacagagatgttcacttctggcactcttagacagtacaggctaaaacataag
aaggttaacattcgagccgtaaagcgttggtgtagacaaatcctgaaagggcttcattac
ctgcatagccatgatcctcctgttatacatagagacctcaagtgtgataacattttcatc
aatgggaatcagggcgaagtcaaaattggtgatcttggccttgctgccatcctccgcaaa
tcccatgctgcacgttgtgtaggaacaccagagtttatggctccagaggtgtacgcggag
gagtacaatgaattagtggacatttattcatttggaatgtgtattttagaaatggtgacc
tttgaatatccatacagtgagtgcactcatcctgctcagatctacaaaaaagtgacatct
gggaaaaagccagattctctttacaaagtcacagatccggaggttcgtcgatttgttgag
aaatgcttggcaacggtatctcacagactatccgcaagggaacttcttgatgaccctttt
ctccaagttgatgattatgtatccgactcagacacaccaaattatttgcaagactctgac
gaattagaccctaccttggggcatcgaccctcgagcatatgtgataacaactctcttgta
aatggttgtcttggttaccttggatatgaaccagaggatgattcgtactatcatcaactt
gagtatgaggcaaatgaaattgatctattcacagacaacgaagaggatgatatggaaaat
attgatatcagcatcaagggaaggaggaaagatgacgatggcatctttttacgactcagg
atagcagataaagaaggtcgcgtccgcaacatttattttccttttgacattgagaatgac
acagcactaactgtcgctactgaaatggtggccgagttggatattacagaacaagatgtt
accaaaatagcagacatgattgatggcgagattgctttgttagtgcctgagtggaagagg
gggtttgtgatagaggaaagccccgactacatgaaccgtggctgctgtcacaaatgtgct
tctaatggttctcttgtgaactacctatcatccaatagtccagcaccgcctaggaacttg
caagtgctacattgttccaagcatggatgtggtgctatgcatggccgttttgaggagata
acataccattttgatggctctgaacaatgtctcactgaccgtgctcctgaaggctcattg
gaatctgatggtgtacactatactgatatttgggcacaagttgacaaaacaaaatcacgc
ccacggggctctgttgactatcactctgatgttaaagacaaatcggtgaatgaatccaca
tatggttgtgaggagaaacctataagtgtcgataagcatgacaaatctcatccaagccta
caagactcccactcttcaacttcttcaggagctagaactccagtagaagataatgagaat
gagatacggcgggagttgaggtggctcaaggccaagtaccaaatgcaactaagggggctt
aaagatcagcaattaggagttgttccaaaatattcgcgtcaaaggttaagcaacaaaatc
ccaagaaatgataaggtattgtcagattcaactccatcaatagaaaatgatcatcttcta
ctacaatcatttacttcaggcaagaatttttcatcagacattcccatagaaatcgagaac
gaatgttctaattctaaagtcagaagatatccacttgcatatggatcttgcagcccagag
cacatggtcactgcacagagcttctatacaggggcactactccccaactcacttcacagg
gccacatctcttcctgtagatgccatagattgctaa

DBGET integrated database retrieval system