KEGG   Capsicum annuum: 107864654Help
Entry
107864654         CDS       T04646                                 

Definition
(RefSeq) probable nucleolar protein 5-2
  KO
K14565  nucleolar protein 58
Organism
cann  Capsicum annuum
Pathway
cann03008  Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    107864654
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cann03009]
    107864654
Ribosome biogenesis [BR:cann03009]
 Eukaryotic type
  Sno RNPs
   Box C/D snoRNPs
    107864654
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nop NOP5NT
Motif
Other DBs
NCBI-GeneID: 107864654
NCBI-ProteinID: XP_016566572
UniProt: A0A1U8G5E2
Position
3
AA seq 553 aa AA seqDB search
MLVLFETPAGFALFKVLDEGKLSKVEDLWKEFSSTDSARKVVKLKAFSKFENTSEALSAA
TLLIDSKPSKGLRKFLKAHCDGETLGVADSKLGNAIKEKLQIDCVHNNAVMELMRGLRSQ
LTELISGLASQDLAPMSLGLSHSLSRYKLKFSPDKVDTMIVQAIGLLDDLDKELNTYAMR
VREWYGWHFPELAKIVQDNILYAKAVKLMGDRTNAAKLDFSEILPEEVEAELKEAAMISM
GTEISDLDLENIKDLCSQVLSFSEYRAQLYDYLKSRMNTIAPNLTALVGELVGARLIAHG
GSLLNLAKQPGSTVQILGAEKALFRALKTKHATPKYGLIYHASLIGQAAPKHKGKISRSL
AAKTALAIRYDALADSQDNTMGLENRLKLEARLRALEGKELNKSAGSAKGKPKIEFYDKD
RKKGALITPAKVYNPSADSVMGHTDNDEKKMSIDEQPSQTEEEAGEEAPVTEGEKKKNKK
KKSVETEDGAEPEDTPKKKKKKKKHADNEVDEDVETEKSKKKKKRKHADADEDETETTDK
KKEKKKKKKKTEE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgttggtattgtttgaaacccctgctggctttgcccttttcaaagttttagatgaagga
aagctctccaaagttgaggatttgtggaaggagttctcctcaactgattctgcaagaaag
gttgtgaagctaaaagctttctctaagtttgagaacacttcagaagctctgtcagcagct
acgctgttgatagatagcaagccaagcaaaggattgcgcaagttcttgaaagcgcattgt
gatggcgaaacgttgggggttgctgattcaaagcttggaaatgcaattaaggagaaattg
caaatcgattgtgttcataataatgctgtcatggagttgatgagagggcttagaagtcag
ttgactgagctcatttctggtcttgcatctcaagacttggctccaatgagcttgggttta
tctcacagtctttcaagatacaagctaaagtttagccctgacaaggtggatacaatgatt
gtacaggccattggcttgttggatgatctcgataaagagctaaatacatatgccatgagg
gtccgagaatggtatggttggcattttccagaacttgcaaaaattgtacaagataacatt
ctttatgccaaggctgtgaaattgatgggtgaccgtacaaatgctgcaaagctggatttc
tctgagatactcccagaagaggttgaggcagaattgaaagaggcagcaatgatctccatg
ggcactgaaattagtgaccttgatctggagaatattaaagatttatgcagccaagttttg
tcattctccgagtacagagctcagttatatgattatttgaagagcaggatgaacaccatc
gccccaaatcttacggctcttgttggagaacttgttggtgctcggcttattgctcatggt
ggtagcttgttaaatcttgcgaagcaacctggaagtacagttcagatacttggtgctgaa
aaggctcttttcagagctttgaagacaaaacacgcaactccaaaatatgggcttatttat
catgcatctttgattggacaggcagcaccaaaacacaagggtaaaatttcaagatctctt
gctgcaaaaactgctttggctattcgatacgatgcccttgcagatagccaagataatacc
atgggtttggagaatcggctcaagcttgaagcacgcttaagagccttagaaggcaaagag
ttgaacaaatcagctggatctgctaagggcaaacctaagattgaattttatgacaaggat
cgtaaaaaaggagcgctgataacaccagctaaggtttacaatccttctgctgattctgtc
atgggacacactgataatgacgagaaaaaaatgagtatagatgaacagccatctcaaacc
gaggaagaagcaggtgaggaagcccccgttactgaaggagagaagaaaaagaataagaag
aagaaatctgttgagacagaagatggtgccgaacctgaagacactccgaagaagaagaag
aaaaagaagaaacatgcagataatgaagtggacgaagatgttgaaacggaaaaaagcaag
aaaaagaagaagaggaaacatgctgatgccgatgaggatgaaacagaaaccactgataaa
aagaaagagaaaaagaagaagaagaagaaaactgaagagtaa

DBGET integrated database retrieval system