KEGG   Capsicum annuum: 107866963Help
Entry
107866963         CDS       T04646                                 

Definition
(RefSeq) mitogen-activated protein kinase homolog NTF3
  KO
K20535  mitogen-activated protein kinase 1/2 [EC:2.7.11.24]
Organism
cann  Capsicum annuum
Pathway
cann04016  MAPK signaling pathway - plant
Brite
KEGG Orthology (KO) [BR:cann00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    107866963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:cann01001]
    107866963
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107866963
Protein kinases [BR:cann01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107866963
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Pkinase_fungal FTA2 Abi_C
Motif
Other DBs
NCBI-GeneID: 107866963
NCBI-ProteinID: XP_016568514
UniProt: A0A2G2ZS93 A0A1U8GBK0
Position
4
AA seq 372 aa AA seqDB search
MATPVEPPNGVRTPGKHYYSMWQSLFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKINNAFENRVDALRTLRELKLLRHLRHENVIALKDVMMPIHRRSFKDVYLVYELMDTDL
HQIVKSSQTLTNDHCQYFLFQLLRGLKYLHSANILHRDLKPGNLLINANCDLKICDFGLA
RTSSGKDQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPVFPGTECL
NQLKLIINILGSQREEDLEFIDNPKARKYIKSLPYSPGTPFSRLYPQAHPLAIDLLQRML
VFDPSKRISVMEALQHPYMSPLYDPNTDAPAQVPINLDIDEDLGEETIRDMMWTEILHYH
PEDTAAAMEAVL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcaactccagttgagccaccaaatggggttaggaccccagggaagcattactattct
atgtggcaatccctttttgaaatcgatacaaaatatgtacctattaagcctattggtcga
ggggcatatggaattgtttgttcttctgttaacagggaaacaaatgagaaggttgcaatc
aagaaaataaacaatgcttttgagaatcgtgttgatgctctgagaacgttgcgtgaactg
aagctccttcgccaccttagacatgaaaatgtgattgctctgaaagatgtcatgatgcca
atccacaggcgaagtttcaaagatgtttatctggtttatgaactgatggatacagattta
catcagatagtcaaatcctctcaaacacttacaaatgatcattgtcagtatttcctattc
cagttgcttcgcggtctgaagtatctccattctgcaaatattcttcatcgtgacttgaag
cccgggaacctgcttatcaatgctaactgtgatctgaaaatctgtgatttcgggcttgca
cgtacaagcagtggcaaggaccagttcatgactgaatatgtagttacacgctggtatagg
gctccggaactcctcctttgctgtgacaactatggaacttctattgatgtatggtctgtt
ggttgcattttcgcggagctcttagggaggaagcccgtctttccaggtaccgaatgcctt
aaccaactgaaactgattatcaacatccttggcagccagagggaagaagatttagaattt
atcgacaatccaaaggcgaggaagtacatcaaatcacttccatactctcccggaacacca
ttttcccgcctctatccccaagctcatcctttggccattgatctcctgcagaggatgctc
gtctttgacccttcaaaaagaatcagcgtcatggaagcacttcaacacccgtacatgtct
cctttgtatgatccgaacactgatgcccctgcacaggttcctatcaatcttgacatagac
gaggacttgggggaagagacgataagggacatgatgtggacggaaatacttcattaccat
cctgaagacaccgcagctgctatggaagctgttctgtaa

DBGET integrated database retrieval system