KEGG   Capsicum annuum: 107866980Help
Entry
107866980         CDS       T04646                                 

Definition
(RefSeq) ornithine carbamoyltransferase, chloroplastic
  KO
K00611  ornithine carbamoyltransferase [EC:2.1.3.3]
Organism
cann  Capsicum annuum
Pathway
cann00220  Arginine biosynthesis
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
cann01230  Biosynthesis of amino acids
Module
cann_M00844  Arginine biosynthesis, ornithine => arginine
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    107866980
Enzymes [BR:cann01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.3  ornithine carbamoyltransferase
     107866980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OTCace OTCace_N cEGF
Motif
Other DBs
NCBI-GeneID: 107866980
NCBI-ProteinID: XP_016568535
UniProt: A0A1U8GBM0 A0A2G2ZSA9
Position
4
AA seq 397 aa AA seqDB search
MLSRVYYQHKLYFLSPKLKQIHRALLDTMAAIFCNLSSLRSPDSPSFSSLSSSGIQWSRF
SGVFSPSPITFPAIRRRVSCQSTSPATSSVNANAKDFLHISDFDKSTILNVLDRAKEVKA
LIKSGERTYLPFKGKTMAMIFAKPSMRTRVSFETGFYLLGGHAIYLGPDDIQMAKREETR
DVARVLSRYNDVIMARVFAHQDILDLAKYATVPVINGLTDYNHPCQIMADALTIVEHVGQ
LEGTKVVYIGDGNNIVHSWLLLASVIPFHFVCACPKGFEPDQETVKKAQNAGVSKIEITN
DPKEAVKGADVVYSDVWASMGQKEEAAQRRRVFQGFQVDEGLMKIAGQKAYFMHCLPAER
GVEVTNGVIEAPNSIVWDQAENRMHAQNVIMLHVMGL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcttagtagggtttattatcaacacaaattatactttctttcccccaaactaaaacaa
atccaccgagctctacttgacacaatggccgccattttctgtaacttatcttccctccga
tcacccgattccccctcattctcctctctctccagctccggcattcaatggtcacgcttt
tccggtgtattttcaccttctccgatcacatttccggccattcgtagacgtgtctcatgc
cagtccacttctccggcaacctcctccgtcaacgcaaatgccaaggactttctgcacata
agcgattttgataaatcaactattttgaacgtcttggatcgagccaaagaggtcaaagca
cttataaaatcaggagagaggacatatcttccatttaaaggtaaaacaatggcgatgata
tttgctaagccatctatgaggacaagggtttcctttgagacagggttttacttgcttggt
ggccacgccatatacttgggaccagatgacatacagatggctaagcgggaagaaactcgt
gatgttgctcgtgttttgtctcgctataatgatgtcattatggctcgagtttttgctcat
caggatattctagatcttgctaaatatgcaacggtaccagtgattaatggtctgacagac
tacaaccatccttgccaaattatggctgatgcccttacaatagttgaacatgttggtcag
ctggaaggaactaaggttgtctatattggagatggaaacaacatagtgcattcttggttg
ttgctggcgtcagtaattcctttccactttgtttgtgcctgtccaaaaggtttcgaacct
gatcaggaaacagttaagaaagcacaaaatgctggagtaagcaaaattgagataactaat
gatccaaaggaagctgttaaaggagctgatgttgtatactcggatgtctgggcgagcatg
ggacaaaaggaagaagctgcacagcgtcgtcgggtgtttcaaggattccaggtggatgaa
ggactcatgaaaatagctggacagaaggcttattttatgcattgtttgcctgcagagagg
ggtgtcgaagtcactaatggcgtgattgaagcgccaaactcaattgtatgggaccaagct
gaaaaccgcatgcatgcacaaaatgtaattatgcttcatgtaatgggcttgtaa

DBGET integrated database retrieval system