KEGG   Capsicum annuum: 107867306Help
Entry
107867306         CDS       T04646                                 

Definition
(RefSeq) inositol-tetrakisphosphate 1-kinase 3-like
  KO
K00913  inositol-1,3,4-trisphosphate 5/6-kinase / inositol-tetrakisphosphate 1-kinase [EC:2.7.1.159 2.7.1.134]
Organism
cann  Capsicum annuum
Pathway
cann00562  Inositol phosphate metabolism
cann01100  Metabolic pathways
cann04070  Phosphatidylinositol signaling system
Module
cann_M00132  Inositol phosphate metabolism, Ins(1,3,4)P3 => phytate
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    107867306
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    107867306
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.134  inositol-tetrakisphosphate 1-kinase
     107867306
    2.7.1.159  inositol-1,3,4-trisphosphate 5/6-kinase
     107867306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins134_P3_kin Ins134_P3_kin_N
Motif
Other DBs
NCBI-GeneID: 107867306
NCBI-ProteinID: XP_016568959
UniProt: A0A1U8GLI7
Position
4
AA seq 356 aa AA seqDB search
MRMRGEIVGYKREMEDEEEEDYSTEEMNHREKEMVGGGVPQSKKFVVVVGYALTSKKVMS
FLQPKLEGLARSKGILFVAIDQNKPLSDQGPFDIVLHKLSGSKWRRNLEEYRLTHPDVTV
LDPPDAIQQVYNRQYMLEDVADLNLSDTYEVGRGPNAGLLGKVGVPRQLVIEKDSSSIPD
AVGKAGLRLPIVAKPLAAKSHELSLAYDKFSLQMLEPPLVLQEFINHGGILFKVYIVGET
VKVVRRFSLPDVSKRELSKNPGVFRFPRVSCAAASADEADLDPCVGELPPRPLLERLAKE
LRRRSGLRLFNLDIIRELGTEDRYYVIDINYFPGYGKMPEYEHIFTDFLLSLVKQK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaggatgaggggtgagatagtggggtacaagagggagatggaagatgaggaagaggaa
gattacagcacagaagaaatgaaccacagggaaaaggaaatggttggtggaggggtacca
cagtctaagaagtttgttgtggtggtgggttatgctcttacttccaagaaagttatgagc
tttttgcagcctaaacttgaaggtctagctaggtcgaagggaatattgtttgttgctatt
gatcagaacaaacccctttcagatcaaggtccttttgacattgtgctccataagttgtca
ggaagcaagtggcggcgtaatcttgaggaatataggctaacacatccagatgtcacagtt
cttgaccctccggatgccatacagcaagtatacaaccgccaatacatgcttgaagatgtt
gcggacctgaacttgtcggacacgtatgaagtggggagagggccaaatgccgggcttctg
gggaaagtcggtgttccaaggcaactggttattgagaaagattcttcatctattccggat
gcagtaggtaaagctggtctgagactacctattgttgcaaagcctttggctgctaagtcc
catgagttgtctctcgcctatgacaagttctctcttcagatgcttgaacccccacttgtg
ctacaggaatttatcaaccatggaggtattctgtttaaggtatacattgtcggggaaaca
gttaaggtggttagacgattcagtttacctgatgttagcaaacgtgagctgtcaaaaaac
ccaggggttttccgattcccaagagtttcttgtgctgctgcatctgcagatgaagcagat
ttagacccttgtgtcggggagcttcctccgcgaccattacttgagaggcttgctaaggaa
cttcgacgtagatcgggactccggctcttcaacttggatataataagagagcttggaacc
gaagaccgatattatgtcatagatattaattactttcctggttatgggaagatgccagag
tatgagcacatattcactgattttcttctgagccttgtgaagcagaaatag

DBGET integrated database retrieval system