KEGG   Capsicum annuum: 107867323Help
Entry
107867323         CDS       T04646                                 

Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
cann  Capsicum annuum
Pathway
cann00052  Galactose metabolism
cann00500  Starch and sucrose metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    107867323
   00500 Starch and sucrose metabolism
    107867323
Enzymes [BR:cann01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     107867323
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 107867323
NCBI-ProteinID: XP_016568986
UniProt: A0A1U8GCD5
Position
1
AA seq 656 aa AA seqDB search
MALSNSEETNNGVAYTQLPEAETASHNSPASTYGRSKRVTFMILTTFVVFILFFVAVKYG
SYEDIDDVNPGSDPSQDTVCNILGSNLMPLTTMRMVERGVAEGVSAKSHGHFLGARPFPW
TKNMLIWQRTSFHFQPKKNWMNDPNGPLYYKGWYHLFYQYNPEAAVWGNIVWGHAVSRDL
IHWQHLPVAMVGDQWYDINGAWTGSATFLPDGSLIMLYTGSTNESVQVQNLAYPADPSDH
LLRKWVKYEGNPVLVPPPGIAKKDFRDPTTAWTTPEGKWRITIGSKVNKTGISLVYDTVD
FKNFELLEGVLHGVPGTGMWECVDFYPVSKVAENGLDTSENGPAVKHVLKSSLDDDRNDY
YALGTYDALNGKWVPDNPTIDVGIGLRYDYGNFYASKTFYDQEKKRRVLWAWIKETDSEA
ADICKGWASLQPIPRTIKFDKKTGSNIITWPVSEVETLRSNRVEFDKVKVNPGSIVPLEV
GSAAQLDIMAEFEVNQKVLERIDGSNGTYDCINSGGSAERGAFGPFGLLVLTDNGLSEQT
PIYFYIAKDAKGNFNTFFCNDLTRSSEASDVHRLMYGSTVPVLQGEKLTLRTLVDHSIVE
SFAQGGRTAITSRVYPTKAIYEDAKLYLFNNATDISITATLKIWQMDSANIQSTYT
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggcactctctaattcagaggaaacaaataatggcgttgcatacacacaattaccggag
gcggagaccgcctcccataattctccggcatcaacatacgggagatcgaaaagagttacg
tttatgatattaacaacgtttgtggtgtttatattatttttcgtagcggtaaaatacggt
agttatgaagatattgatgatgtaaatccaggatcggatccatcacaagatacggtgtgt
aacatactcggctctaatctaatgccattgaccaccatgaggatggtggagcgtggtgtg
gcggaaggcgtctctgccaagtcacatggacattttttgggtgcacggccatttccgtgg
accaaaaatatgttgatttggcaaagaacgtccttccactttcaacctaagaagaattgg
atgaatgatccgaatggtccattatactacaaaggatggtaccatttgttctatcaatac
aatccagaggcagctgtatggggaaacattgtgtggggccatgcagtctcacgcgaccta
atccactggcagcatctgccagtggccatggtaggtgatcaatggtacgacattaacggt
gcatggaccggatccgctacctttttaccagatggtagtctcatcatgttatacaccggg
tcaaccaacgaatcggtccaggtccaaaacctggcgtacccagccgacccatcagatcat
ctcttaagaaaatgggtcaagtatgagggcaacccggtcctggtcccaccacccggtatt
gccaagaaggacttccgtgaccccacgaccgcgtggaccacgccggagggcaaatggcgg
attactattggctcaaaagttaataaaaccggaatctcattggtctatgacacagttgat
tttaagaattttgaattattagaaggtgtgttacatggtgtaccgggtacgggtatgtgg
gagtgtgtggacttttacccggtatcgaaagttgctgaaaatgggctggacacttcagaa
aatgggcctgcagttaaacatgtattgaagtccagcctcgacgatgatcgaaatgactat
tatgcccttggtacgtatgatgcattgaatggaaaatgggttccagataacccaactatt
gatgttggcattggactaagatatgattatggtaatttttatgcatcaaaaacattttat
gaccaagagaaaaagagaagagtcctttgggcttggatcaaagaaactgatagtgaagct
gctgatatttgcaagggttgggcctcacttcagccaattccaaggactataaagtttgat
aagaagactggaagcaacataattacatggccagtgtcagaggtagaaactttgagatca
aacagagtcgaatttgataaggttaaggttaatccagggtcaattgtcccactagaagtt
ggttccgccgctcagttggacataatggctgaatttgaagtaaaccaaaaggtgttggag
agaatagatggtagtaatggaacatatgattgtataaacagtggtgggtctgctgaacgt
ggtgcatttggaccatttggtttattggttctaacagataatggcttatcagaacaaaca
ccaatctatttctacattgctaaggatgctaaaggcaatttcaacacttttttctgcaat
gatctcaccaggtcatctgaagcatcagatgttcatagattaatgtatggcagcactgtt
ccagttctccaaggagagaaacttactctaagaacactggtggatcattcaatagtagaa
agttttgcacaaggtggaaggacagctataacatcaagggtatatccaacaaaggcaata
tatgaagatgctaagctctatttatttaacaatgccactgatattagcattactgccaca
ctcaagatttggcaaatggattctgctaatatacaatctacttatacttaa

DBGET integrated database retrieval system