KEGG   Capsicum annuum: 107867390Help
Entry
107867390         CDS       T04646                                 

Definition
(RefSeq) protein CutA, chloroplastic
  KO
K03926  periplasmic divalent cation tolerance protein
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    107867390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CutA1
Motif
Other DBs
NCBI-GeneID: 107867390
NCBI-ProteinID: XP_016569091
UniProt: A0A1U8GCN4
Position
4
AA seq 184 aa AA seqDB search
MALTLSTITTSTLIRRKLPIVGAFCVLTFGLSNLSIPFTHTSFAHSLPFVPLLRSKLGGE
RRSTSVSSRIRMEASNKIVPSIVVYVTVPNKDLGIKLAGSIVKEKLAACVNRVPGVESVY
EWQGEIQTDSEELLIIKTRESLLEALTEHVKANHEYDAPEVIAMPIVGGSPQYLEWLKNS
TRDK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcattaacactctcaacaataacaacatcaaccttaatccgtcgaaaattacccata
gtaggtgccttttgtgttcttacctttggtctctctaatctctccatcccttttacccat
accagctttgctcattcacttccctttgtccctcttttgcggtcgaaattaggtggagaa
agaaggagtacaagtgttagtagtagaataagaatggaggctagtaacaagattgttccc
agcattgttgtttatgtcactgttcctaacaaagacttgggtataaagctggcagggagc
atagtcaaggagaaactcgcagcatgtgttaatcgagtaccaggcgtcgaatctgtttac
gagtggcaaggagagatacagactgattctgaagagctgcttataatcaagaccagggag
tcccttttggaagctcttacggagcatgtgaaggccaaccatgaatatgatgctcctgaa
gtgattgcgatgcccatagttggtggcagtccccagtacctagaatggctcaagaacagc
acaagggataaatga

DBGET integrated database retrieval system