KEGG   Capsicum annuum: 107869992Help
Entry
107869992         CDS       T04646                                 

Definition
(RefSeq) uncharacterized LOC107869992
  KO
K02890  large subunit ribosomal protein L22
Organism
cann  Capsicum annuum
Pathway
cann03010  Ribosome
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    107869992
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cann03011]
    107869992
Ribosome [BR:cann03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    107869992
  Bacteria
    107869992
  Archaea
    107869992
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-GeneID: 107869992
NCBI-ProteinID: XP_016571848
UniProt: A0A1U8GSU1
Position
5
AA seq 271 aa AA seqDB search
MAGWQRHLQCILRQAGKRYQQNQPVPFNSLFHPKATPVLGEVPYLPRLQNKLSPCNSRPL
YQYLQHLGLSSSRTLLADDATPISSPLTPLLTSSTGSTEAEKAISKPSKVQAVLKGIKQS
PKKVNLVAALVRGMRVEDALLQLQVKVKRAAKTVYQVIHSARANAVHNHGFDPDRLLVAE
AFLGKGLFKKRLSYHAKGKCGMMVSPECRLTVVLREITPEEEAEIAKLRVSNFKKLSKRE
RRLVPHKLIETTPIWNRKGKPRSSGAGAVAE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcgggctggcaacggcatcttcagtgcatacttcgtcaggctgggaagagatatcaa
caaaatcaacctgttcctttcaattcattgtttcacccaaaggcaactccagtacttggt
gaggtaccttatttaccaaggctgcagaataaactttccccttgcaactcaaggccattg
taccaatatctacaacatctggggttgtctagttcaaggacattacttgcagatgatgca
acgccaatttcttctccattaacaccactgttaacatcaagtacgggaagtacagaagca
gagaaagcaatttctaaaccttcaaaagttcaagcagttttgaagggtataaaacagagc
ccgaagaaggtgaacttggttgctgcattagttcgtggtatgcgtgttgaagatgcattg
ttacaattgcaagtgaaggtaaagcgagctgccaaaactgtctatcaggttatacactcg
gctcgggcgaatgcagtgcataaccatggatttgatccggaccgacttcttgttgctgag
gcatttcttgggaagggacttttcaagaaaagattgtcctaccatgctaaaggaaagtgt
gggatgatggtgagtccggaatgtagactgacagtggtacttagagagataacacccgag
gaggaggccgagatagctaagttgagagtaagcaacttcaaaaagctaagcaaacgcgaa
agacgtcttgtccctcataagctcattgagactactccgatatggaaccgcaagggcaaa
cccagaagtagcggcgcaggtgctgttgcagaatga

DBGET integrated database retrieval system