KEGG   Capsicum annuum: 107871120Help
Entry
107871120         CDS       T04646                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
cann  Capsicum annuum
Pathway
cann00010  Glycolysis / Gluconeogenesis
cann00562  Inositol phosphate metabolism
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107871120
   00562 Inositol phosphate metabolism
    107871120
Enzymes [BR:cann01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     107871120
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     107871120
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 107871120
NCBI-ProteinID: XP_016573408
UniProt: A0A1U8GX79
Position
5
AA seq 502 aa AA seqDB search
MLKNSMNISLLLFLQVVLIAIAVVHTIADESFDVRQHLSTVSRYGTVKDIADDSFVPSQN
LDQCTPIHLNLVARHGTRAPTKKRLRELEAFAARLEVLVRDVKEQKQSLDKIPSWLMGWN
SPWKGKRTGGELISEGEDELYNLGIRARERFPSLFSEEYHPDIYSIKATQVPRASASAVA
FGLGLFSGKGKLGPGGHRAFAVTSESRASDIVLRFHDCCQSYKNFRKSQEPTVKNLKEPI
LDEITRELVRQYGLNFTKQDVSTLWFLCRQEASLLNITNQACSLFGPAQVSLLEWADDLE
LFVLKGYGNSLNYRMGVPLLEDVIQSMEQAIKAKEEGYAPGSYEKASLRFAHAETLLPFS
CLIGLFLEESEFELIQREQTLQYPPKPPKTRNWRGSIVAPFAGNNMLVLYSCTSNNSNKY
FVRVLHNERPIPIPGCNGSDSCPFEVLKERIVAPHLKHDYNTLCNTNLEQKKKDSPPSMF
SRMFGWIFSSRNADTPTQKVEL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgttgaagaactcaatgaatattagtctgctgctattccttcaagttgtactcattgca
attgcggttgtacacacaatagctgatgaatccttcgacgttcgtcaacatctatctact
gtatccaggtatggtactgtgaaggatatagctgacgattcctttgtgccttcccaaaat
cttgatcagtgtacacctattcatttgaatcttgtggcacggcatggcactcgtgctcct
acaaagaaaaggctaagggagctagaagcctttgctgctcgattggaagtccttgtacgt
gacgttaaggaacagaagcagtctttggataaaattccttcttggttaatggggtggaac
tctccttggaagggaaaacgtacaggtggagagctgatcagtgaaggcgaagatgagtta
tataatcttggtattagagccagagaacgatttcccagcctgtttagtgaagaataccac
cctgatatttattcaatcaaggctacccaggttcctcgagcatcagctagcgctgtggca
tttggcctgggtctgtttagtggaaaagggaagcttggaccaggcggtcatcgagctttt
gctgttacaagtgaaagtcgtgcaagtgatatagtcttgagatttcacgattgttgtcaa
agctacaagaatttcaggaaaagtcaggaaccaaccgtaaagaatctcaaagaacctata
ttagatgaaattactcgtgaactagtgaggcaatatgggcttaattttacaaaacaggat
gtatctactctatggtttttatgcagacaggaggcttcactgttgaacatcaccaatcaa
gcttgtagtctattcggtccggcacaggtttctttgttggaatgggccgacgatttggag
ttattcgtactaaagggctatggtaattcactaaattaccgaatgggagtgccgctactt
gaggatgtaattcaatccatggaacaggcaattaaggctaaagaagaaggatatgctcct
gggagctatgaaaaggcgagtctacgttttgctcatgcagaaactctgcttcctttttca
tgcttgatcggactctttcttgaagaatctgaatttgaattaatacaaagagagcagaca
ttgcaataccctcctaagcctcctaaaacaagaaactggcggggaagtatagtggcacct
tttgctggcaataacatgctagtcctttacagctgcacgtcaaacaactcaaacaagtac
ttcgtgagagtgttgcacaatgaacggcccattccaataccaggttgcaatggctcagat
tcttgcccatttgaagtattgaaggaaagaatagttgctcctcacttgaaacatgactac
aacacgctttgcaatacgaacttggaacaaaaaaagaaggattctcccccaagtatgttc
tcgcgaatgtttggttggattttctcatcgaggaatgctgatacacccacccagaaagtt
gagctctaa

DBGET integrated database retrieval system