KEGG   Capsicum annuum: 107871252Help
Entry
107871252         CDS       T04646                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
cann  Capsicum annuum
Pathway
cann00450  Selenocompound metabolism
cann00970  Aminoacyl-tRNA biosynthesis
cann01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    107871252
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107871252
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cann01007]
    107871252
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cann03016]
    107871252
Enzymes [BR:cann01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     107871252
Amino acid related enzymes [BR:cann01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   107871252
Transfer RNA biogenesis [BR:cann03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107871252
 Prokaryotic type
   Other AARSs
    107871252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Viral_protease Anticodon_1
Motif
Other DBs
NCBI-GeneID: 107871252
NCBI-ProteinID: XP_016573621
UniProt: A0A1U8GQU4
Position
5
AA seq 805 aa AA seqDB search
MGDNCKSTLKVPIAGKRNILITSALPYVNNVPHLGNIIGCVLSADVFARYCRIRGYNAIY
MCGTDEYGTATETKALEENCTPKQICDKYHAIHKDVYKWFDISFDEFGRTSTPQQTEVCQ
AIFKKLWDNNWLSENTMQQLYCDTCKKFLADRLVEGNCPTPGCNYDSARGDQCEKCGKLL
NPTELLEPRCKVCRNTPCIRDTDHLFLELPLLKDKLEAYINEMSVSGGWSQNAIYTTHAW
LREGLKSRCITRDLKWGVPVPHEKYKDKVFYVWFDAPIGYVSITSCYTTEWEKWWKNPDN
VELYQFMGKDNVPFHTVIFPSTLLGTGERWTLMKTISVTEYLNYEAGKFSKSKGIGVFGN
DVKDTNIPVEVWRYYLLTNRPEVSDTLFTWADLQAKLNSELLSNLGNFINRVLSFIAKDQ
ASGYGSIIPDAEGAESHSLTKALGERVGSCVQQYIEAMEKVKLKQGLKVAMSISSEGNGY
LQESQFWKLYKEDRPSCSIVMRTACGLVYLLACLLEPFMPSFSREVLKQLNLPPEMLSLS
DEGGDIENSKRPWNILPAGHRIGTPAPLFKELKDEEVEFYRAKFAGSQADRADRALKAET
EAKNVAEKLNKVKISDGNKKKERATKSSETKSKAPPSVEAEISISRLDIRVGLITKAQKH
PDADSLYVEEIDVGESQPRTVVSGLVKYIPLEEMQNRKVCVLCNLKPASMRGIKSQAMVL
AASNSDHTKVELVEPPKDAVVGERVTFPGFDGKPDDILNPKKKVWETVQVDLHTNKELVA
CYKDVPLTTSVGTCKVASISEGSIR
NT seq 2418 nt NT seq  +upstreamnt  +downstreamnt
atgggggataattgtaaatctactctaaaagtaccaattgcaggaaaaagaaacatccta
attaccagtgctttgccttatgtcaataacgtccctcaccttggcaacattattggatgt
gtgttgagtgcggatgtgtttgcaaggtattgtaggattagagggtacaatgcaatatac
atgtgtggtacagatgagtatgggacggcaactgagactaaagccttggaggaaaattgt
actccaaagcaaatttgtgacaaatatcatgcaattcataaagacgtttataaatggttt
gatataagctttgatgaatttggacgcacatcaacacctcaacagacagaagtttgtcaa
gcaattttcaagaagctctgggacaataattggctttctgagaatacaatgcagcagctt
tattgcgacacctgcaaaaagttcttagcggatagacttgtagagggtaactgtccaacg
ccaggttgcaactatgattctgcacgaggagatcaatgtgagaagtgtgggaaattatta
aatcccacagaactactagagccaagatgcaaggtttgtcgcaacaccccttgtatccga
gatacagatcatttgtttcttgagctccctttgctgaaggataagttagaagcatatatc
aacgaaatgtcagtgtctgggggatggagtcagaatgctatctatacaacacatgcgtgg
cttagagaaggacttaaatcaaggtgtataactagagatttgaagtggggggttccagta
ccacatgaaaaatacaaggataaggttttctatgtatggtttgatgctcctattggatat
gtatcaatcacctcatgctacacaactgagtgggagaagtggtggaagaatccagataat
gtggagctgtatcagtttatgggaaaggacaatgtgccttttcacactgtaatattccca
tctacgcttcttggaactggtgaaagatggacgcttatgaaaactatcagcgtaacagaa
tacttgaactatgaagcaggcaaattctcaaagagcaaaggtataggagttttcggtaat
gatgtaaaagatacaaatattcctgttgaagtatggagatattacttgctgacaaacagg
ccagaggtctcagacactttatttacatgggcagacctacaagcaaagttaaacagtgag
ttgctaagcaacttaggcaattttatcaatagagtcctgagcttcatagcaaaagatcaa
gcctcaggttatggttcgattattcccgacgctgaaggagcagaatcacattccttgaca
aaggcattgggtgaaagagttggaagttgcgtacaacaatatatagaagctatggagaag
gttaaattaaaacaaggtttgaaggttgctatgtccatttctagtgaaggaaacggttat
ctgcaggagagccaattttggaagctttacaaggaagacaggccttcctgttcgatagtg
atgagaactgcttgtggtctagtatatcttttggcatgtcttttagagccttttatgcca
tctttttcacgtgaggtgcttaagcagctcaacttgcctcctgaaatgctttcactgtct
gatgaaggaggtgacattgaaaatagcaaaagaccatggaatattctacctgcaggtcac
agaattggaacaccagcaccattgttcaaggagctgaaagatgaagaagttgagttctac
agagcgaagtttgcaggaagtcaggcagatagggcagatagagctcttaaggcagaaact
gaggccaaaaatgtggctgaaaaattgaataaagtaaaaatatcagatggtaataaaaag
aaagaacgtgcaacaaaatcttctgaaaccaaatccaaggccccaccctctgttgaagcg
gaaatttccattagtagactcgacattcgtgttggcctcataacaaaagcgcagaaacat
cctgacgctgattcactgtacgtagaagagattgatgttggtgaatctcagcccagaact
gttgttagcgggcttgtaaaatatattccactcgaggagatgcagaatcgcaaggtctgt
gttctatgcaacctaaaacctgctagcatgagggggataaagtcccaggcaatggttctt
gccgcttctaatagtgatcacaccaaggttgaactggttgagccaccaaaagatgccgtg
gttggggaacgagttacgttccccgggttcgatggcaagcctgatgatatcttgaaccct
aagaagaaagtttgggagactgttcaggttgatttgcataccaacaaggagttggttgcc
tgctacaaagatgtgccattaaccacatcagttggtacgtgcaaggttgcgtctatttcc
gaaggatcgataaggtag

DBGET integrated database retrieval system