KEGG   Capsicum annuum: 107873929Help
Entry
107873929         CDS       T04646                                 

Definition
(RefSeq) cytochrome P450 94A1-like
  KO
K20769  fatty acid omega-hydroxylase [EC:1.14.-.-]
Organism
cann  Capsicum annuum
Pathway
cann00073  Cutin, suberine and wax biosynthesis
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    107873929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:cann00199]
    107873929
Enzymes [BR:cann01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     107873929
Cytochrome P450 [BR:cann00199]
 Cytochrome P450, plant type
  CYP94 family
   107873929
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 107873929
NCBI-ProteinID: XP_016576335
UniProt: A0A1U8GZ00
Position
6
AA seq 358 aa AA seqDB search
MKELSTRLLPLFSSAHANAFVLDLQEIFGRFTFDMVCQVAFGYDPHYLLPSLIQNSTPLA
DAYRTAIKMSMGRCISPSIFWKVKKFFNIGSEKKLSLAVHELRKFIRSRIIEKKEALLTN
NSNGVPSTFFDRMLAKSDDHKNKSVFDENFYIDEAINLILGAEDTLCSALVWYFWLVSSN
PQVEKEIVREILQKEDSNNLKEMVYMHASICESMRLYPPVPQVSKQAMKDDIWPDGTKVK
KGTRVLYHIFAMGRSPKLWSENWADFEPERWLEREDRTGNWRFIPKDPFTYPVFQAGPRT
CIGKEIAFMQMKLVATIVLRRFQIVPAVEGYSPVYGSCMTSMMRNGFPVQILQRCQNL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaaggagctttctactcgtcttcttcctctcttctcatcagctcatgcaaatgctttt
gtgttggaccttcaagaaatctttggccggttcacatttgacatggtatgtcaagtagca
tttggttatgatcctcactacttgttaccatcattgatacaaaatagcactccgttggca
gatgcttataggaccgcgatcaaaatgtccatggggaggtgtattagcccttcaattttt
tggaaagtgaagaaattttttaatattggatccgaaaagaaactcagtctagcagttcat
gaactccgtaaatttatcagaagcagaatcatagaaaagaaagaagcacttttgacaaac
aattctaatggtgttccaagcactttctttgaccggatgctagcaaagagtgatgatcac
aaaaataagtctgtgtttgatgaaaatttttacattgatgaggctattaatctcatcttg
ggtgcggaagacactttgtgttcagctttagtatggtatttttggttagtctcgagtaat
cctcaagtggaaaaggagatcgtaagagaaattcttcagaaagaggatagtaataatttg
aaggaaatggtatatatgcatgcttctatttgtgaaagcatgagactttacccaccagtc
cctcaagtatcgaagcaagcaatgaaagatgatatttggcctgatggaaccaaggtgaag
aagggaacacgtgttttataccacatttttgctatgggacgatcaccaaaattgtggagt
gaaaattgggcggattttgaacctgagaggtggcttgaaagagaggatagaacagggaat
tggaggtttattccaaaggacccttttacatatcccgtgtttcaagcagggccaaggact
tgtatcggaaaagaaattgctttcatgcaaatgaaattggtggcaacaattgtgctaagg
cgatttcagattgttccagccgtggaaggttatagtccggtttatggttcgtgcatgaca
tccatgatgagaaatggctttccagtgcaaattctgcaacgttgccaaaatttgtaa

DBGET integrated database retrieval system