KEGG   Capsicum annuum: 107876909Help
Entry
107876909         CDS       T04646                                 

Definition
(RefSeq) beta-glucosidase 18-like
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
cann  Capsicum annuum
Pathway
cann00460  Cyanoamino acid metabolism
cann00500  Starch and sucrose metabolism
cann00940  Phenylpropanoid biosynthesis
cann01100  Metabolic pathways
cann01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cann00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    107876909
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    107876909
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    107876909
Enzymes [BR:cann01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     107876909
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 107876909
NCBI-ProteinID: XP_016579211
UniProt: A0A1U8H6U3
Position
7
AA seq 153 aa AA seqDB search
MDKEVKAKVKRLIEGAYNEDVKSLSNWDVFSHINGSIINGANADIANDHYHRYLEDIDIM
ASLGVNAYRFSISWSRILPRGKSGQINPAGIKFYNNLIDNLLLKGITPFVTIHHSDYPQE
FEDRYGAWLSPLMQEEFVLFNLLRYVSRVLGIE
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atggacaaggaagttaaagctaaagtgaaaagattgattgaaggagcatataatgaagat
gtcaaaagtcttagcaattgggatgttttctctcatattaatggtagcataataaatgga
gcaaatgcagacatagctaatgaccattaccatcgttatctggaagacattgatataatg
gcctcacttggagtaaatgcctatcgattttctatttcctggagtagaattctacctaga
ggaaaatcaggacaaattaatcctgctggaatcaagttttacaataatctcattgataat
ctcttactcaaaggaataacaccatttgtgactatccatcatagtgactatcctcaagaa
tttgaggacagatatggggcctggctcagtcctctaatgcaggaagagtttgtgctcttt
aatttgctgaggtatgtttcaagagttttgggaatagagtga

DBGET integrated database retrieval system