KEGG   Capsicum annuum: 107878124Help
Entry
107878124         CDS       T04646                                 

Definition
(RefSeq) histidine kinase 2
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
cann  Capsicum annuum
Pathway
cann04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:cann00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    107878124
Enzymes [BR:cann01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     107878124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA
Motif
Other DBs
NCBI-GeneID: 107878124
NCBI-ProteinID: XP_016580494
UniProt: A0A1U8HJ01
Position
7
AA seq 1262 aa AA seqDB search
MSFSVLGGFALKFSRHFLKICRWILLKMSLNCKLLGMNGSFSSSFRLKKARESLPGPNCG
WRWQRKLLFLWLIFFGIGFFWLVISLNGVVYSRKQEVSEPNEDKSYFLLERFNVSKEQIQ
ALATLFFEKDQISSLKCSKDHGREMPMSTTITCLLKVLGSESLKHKELYEMVVDNIEAKG
QCPVPDEEALANSEISLDDESLPFVLQRISSLVSTDPQFFEKEASQIREIGNHNPDYFDG
IAFCLTKLCWWVLLGIVVSWKILESCAKYGVNQQHSFIQQQPILKHPLQQQQQQQQQARF
SSRTGGKWRKKALVIFVFSGVILSIWLYLYLSADIALRREETLTSMCDERARMLQDQFNV
SMNHVHALAILVSTFHHGKQPSAIDQKTFEEYTERTAFERPLTSGVAYALRVLHAEREEF
EKLHGWTIKKMESEDQTLAQDYIPANLDPAPDQDEYAPVIFSQQTVSHIVSIDMMSGKED
RENILRARASGKGVLTSPFKLLKSNHLGVVLTFAVYNTNLPPYATPADRINATIGYIGAS
YDVPSLVEKLLYQLASKQTIVVNVYDTTNKFSPIKMYGMDENDTELPYVSHLDFGDPARN
HEMHCRFKQKPSPPWTAITLSVGGLVITLLIGHIFDAAIDRIAVVEGQYQDMIVLKHRAE
VADIAKSQFLATVSHEIRTPMNGVLGMLQMLMDTNLDPMQLDYAQTAHNSGKDLISLINE
VLDQAKIESGRLELEAVPFDLRAELDNVSSLFSGKSHEKGIELAVYVSDLVPEVVIGDPG
RFRQIITNLVGNSIKFTDVKGHIFVTVHLADEVKNPRDVKDKVLKQSLTFVQERSNTSWN
TLSGFPVVDRWQSWQKFERLSSMEEEVGKIKLLVTIEDTGVGIPFDAQSRIFTPFMQADS
STSRTYGGTGIGLSISKRLVDLMGGKIGFFSEPGIGSTFSFTAVFARGEEGSLEEQYDPV
VSEFRGLRALVIDDKSIRAEVTRYHLQRLGICVNINSTMRSACSYLSSYSNTSALEHLAV
VFVDEDSWDKETSLTLSNMLKELRPNGSTSALGKPPKICLLCMSSLERDDLKSAGMVDHV
LAKPVRLSGLITCFQEAIGYRHKKQVTRGKPSTLGSLLTGKHILVVDDNVVNRRVAEGAL
KKYGAIVTCVDSGKAALKHLNPPHKFDACFMDFQMPEMDGFEATRQIRNLENKYNEKVDS
GELLPSMSAKVAQWHTPILAMTADVIQATSEECLKCGMDDYVSKPFEEGQLYSAVARFFE
SG
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgagcttttctgttctgggtgggtttgctcttaagttttcaaggcattttctgaagata
tgtaggtggattctattaaagatgtccttaaattgcaaattgttgggcatgaatgggagc
ttttcttcaagttttaggctgaagaaggctagagaatctttgcctggaccaaattgtggg
tggagatggcaaaggaagcttttgtttttatggctcattttctttggaattggatttttt
tggttggtcattagcttaaatggcgttgtttatagtcggaagcaggaggtttcagaacca
aatgaagataaatcttattttcttcttgaacgtttcaatgtcagcaaggaacaaattcaa
gctttagctaccttattctttgaaaaagatcagatttcatccttgaaatgttcaaaagat
catgggcgtgaaatgccgatgagtactaccattacttgccttctcaaggtgctaggttcg
gagagtctgaaacacaaagagctatatgagatggttgtagacaatattgaagcaaaaggc
cagtgcccagttccagatgaggaggcactggcaaatagtgagatttcactagatgacgag
tcgttaccatttgttttgcagcgtatatcttcactagtctcaacagatcctcagttcttt
gaaaaggaagcatcacaaataagagaaattgggaatcataacccagattactttgatggt
attgccttctgtctcacaaaactatgctggtgggtccttctcgggattgtggtcagctgg
aagatacttgagtcatgtgcaaaatatggggtaaatcaacagcacagcttcattcagcag
caacctatcctcaagcatccactacagcagcagcagcagcagcagcagcaagctcggttt
tcctctcgaactggtgggaagtggaggaaaaaggctcttgttatctttgtctttagtggg
gtgatcctatccatctggttgtatttgtacctgagtgcagacattgcattgaggagggaa
gaaacactgacaagcatgtgtgacgaacgagcgcgcatgttgcaggaccagttcaacgta
agcatgaaccatgtgcatgcattggctattcttgtttccacatttcaccatggaaagcaa
ccttctgcaatagaccagaaaacttttgaagaatatactgagagaacagcttttgagagg
ccacttacaagtggtgttgcctatgctttaagggttctacatgcagagagagaagagttt
gagaagctacatgggtggactatcaagaaaatggaatcagaggaccaaactttagcgcag
gattatatccctgcaaacttggatcctgctcctgatcaagatgaatatgcacctgtcata
ttttcacaacaaacggtttctcatatcgtctcgattgatatgatgtctggaaaggaggac
cgtgagaacattttgcgagcaagggcctctggcaagggggttttgacgtcaccctttaaa
ctattgaaatccaatcacctgggtgttgttcttacatttgctgtctataatactaatctc
cctccttatgctaccccagcggaccgcatcaatgctactattgggtacattggtgcttct
tacgatgttccatcattggtcgaaaagcttctgtatcagcttgcgagcaagcaaactatt
gtggtaaatgtttatgacacaactaacaagttttctccaattaaaatgtatggcatggat
gagaacgacacagaattaccgtatgtcagccaccttgattttggggatccagcgaggaac
catgagatgcattgcaggttcaagcagaaaccttctccaccctggacagcaataactcta
tctgtcggaggccttgttatcactctgcttattggtcatatcttcgatgctgccatcgac
agaattgctgtagttgagggtcagtatcaggacatgattgtgctcaaacatcgtgctgag
gttgcagatatagcaaaatctcagtttcttgcaacggtttctcatgaaatcaggactccg
atgaatggtgtgttaggcatgcttcaaatgctcatggacaccaaccttgacccaatgcaa
ctggattatgcacaaactgctcataatagtgggaaagatctgatatcattgattaatgag
gtgctggatcaagctaagattgaatcgggaaggcttgagctggaggctgttccttttgat
ctccgtgctgagcttgataatgtttcatcactcttctcaggaaaatctcatgaaaaaggg
attgagttggctgtttatgtatctgatttagtcccagaagttgttattggagatccagga
cggttccggcagataattacgaatctagttggaaactcaattaagttcacagatgtcaaa
gggcacatatttgtcacagtacatttagctgatgaagtgaagaaccctcgtgatgtgaaa
gataaagtcttgaaacaaagcttaacctttgttcaagaaagatcaaatacatcttggaat
accttaagtgggtttcctgtagtcgacagatggcaaagttggcaaaagtttgaaaggcta
agcagcatggaggaagaagtgggaaagatcaagttgttagtgaccatagaagacactggc
gtgggaattccttttgacgcacagagccgcattttcacaccttttatgcaggctgacagt
tcaacatctcgaacatatggtggaacagggataggattgagcattagcaaacgtttggtg
gacctcatgggtggaaaaataggctttttcagtgaacctggcatagggagtacattttca
ttcactgcagtctttgcaagaggagaagaaggttctttagaggaacagtatgatccagtt
gtttcagaatttcgtgggttaagggcattggtgattgatgataaaagcattcgggcagag
gtcacaagatatcatttgcagagactgggaatatgcgtcaacataaattccacaatgcgt
tcagcatgttcatatctctctagttactctaatactagtgcattggaacatttagctgtg
gtttttgttgacgaggatagttgggataaagaaacttctcttacactaagtaatatgttg
aaagagctcagaccaaatggctcaacttctgctttgggaaagcctccaaaaatctgtctc
ttatgtatgagctctttggagagagatgatctcaaatcagctggaatggtggaccacgtt
ttagcaaagcccgtgcggttaagtgggttgataacatgctttcaagaagccattggctac
aggcataagaagcaagtgacccgaggaaaaccttcaactcttggaagcctgctgacagga
aagcatatattggtggtagacgataatgttgtaaacaggagagtggcagaaggtgctcta
aagaagtatggggcgatagtgacctgtgtagacagtggaaaggctgctttgaaacatctt
aatccaccgcacaagtttgatgcttgttttatggacttccaaatgcctgaaatggatggg
tttgaagcgacacgacagatacgcaatctagaaaacaagtacaatgaaaaagtcgattct
ggtgagttacttcccagcatgtctgctaaagtggcacagtggcacaccccaatattagca
atgacagcagatgtaattcaagcaacaagtgaagagtgcttaaagtgtgggatggatgat
tatgtatcaaaaccttttgaagaagggcagctttattcagcagtggcacgcttctttgag
tcaggctga

DBGET integrated database retrieval system