KEGG   Capsicum annuum: 107879277Help
Entry
107879277         CDS       T04646                                 

Definition
(RefSeq) Fanconi anemia group D2 protein homolog
  KO
K10891  fanconi anemia group D2 protein
Organism
cann  Capsicum annuum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cann03400]
    107879277
DNA repair and recombination proteins [BR:cann03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   FA (Fanconi anemia) pathway
    FANCD2-I complex
     107879277
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FancD2 FANCI_S2 FANCI_S1 ANAPC8 DUF1722
Motif
Other DBs
NCBI-GeneID: 107879277
NCBI-ProteinID: XP_016581834
UniProt: A0A1U8HMS9
Position
8
AA seq 1487 aa AA seqDB search
MVLLQNKQIGPRKRPAKSKTGFVTPFAPPAKIPKLAPANEESVPQKIASQSEAANEENVP
RKIASQSEAANEESVPQKIASQPELESEASNLRQSQIVSATEKMISVLADAGCTLINPLG
PPCLPSDLHKLRNKLQSVLSSDSSRKSEFLQGLSSYVNSHSNLRRILSPSRRDGLGSLRS
DSLARVLLLVPSVQSDIQNLLLEKLPEYFDVDPAGSIGGRSSSLCIEEDIARLILNQFRW
LDFLVDSEAFTEKLLQVLSISPVHLKKEIIGSLPEIIGEKNNKTVIDSLQDMLQEDSSII
VPMLDCFSNLHLDDMLQDQVITVALSCIXTIDAEHIPYLLRFLLLLATPTNIRRIISHIR
HQLKLVGASNVWTTQQSKMKGKSVVNNEEASILDALRTSLRFLINCWXVICQETLNELKS
LEKVQDHKVIDIWLLMLIYMNNEPLQKIVEKLLKKKILEGCIVETMFDQCVSGNTDLARD
YLPTLLSISEYLLACKEDKAREFGIHMYTNLFKELVDSYSRQEVLGTLITHVGSGISHEV
SSAMDVMVLLASKYSQELVPLSSHITGILDYLEAFSVENLHKVYETFSLLAFSAEVTAGP
FGSPISNELLVIVRKQLSHPDLIYKKMGLIGTLKIVSYLGDAKTTKLLPSSMSNYEEALE
LLETSMNSCKKLPLPLIMFYDELAFTLKKKALHPAIVEWTSKHVGDFETKFLCDLDGGVL
MVKELYCGLEGDLWMNLDGDISPICLNILPLVSSSLRAASSLQILPANFVLLSSIEGLAN
QGSLAGIDALLGCPIHLPSSKFFCEMLWGSLSGKQKQIIILSLYYAANWLRELLNAFCTQ
AVDEFNAASQATREEITLKLFKRLRNLVFLESLLNSSSNSALFPYLHSNLIWSPCRYQLD
HNRNQEMKNENGNGNIGPSQKRKKEKKSSQISLTDGKFRQPTIMDALRKAGAIPSQEPST
GPSGMCSKGSASEPSRNQQCNINMSANVDVSTAVDHVEAQRHKFRPLLLDCFTILTFQKT
QHSCCADPAAELPLCLYILRDLNRKLDYFNPXRHILVRHMSVPLAFGEMKVIEFISKIQP
LFPSLRRHLDSAVSGLREDTDTCPDHWRTHSAFAGNPDIPNVTSFRPSASRSVIKETLQC
FGKALNIPDVQRDRSVLSDLLEAFQPISISDCFFKGMQLIPSLGDIAYLYAGAYSFVGNI
FDAACAVSFALASEVLLSLESMLVSFRTVLGNNLNDIGKDIRTGFSKELSSFLSKKLGTF
AYKLLMQKSYGVNDTEDGQKVKAEVIQKLLRIYLENSQSTSDSLSELACSVLPQVSSRRS
AVEDGCCFPTLCPATFCIWYRVLHEENLAMIRLVKEILLLEKARGGGEVEEVKCLLKKLQ
QSVNVAVSLVNLCKTHDKVNVRAIAVKFGGKFVDSFLKAFGFLQGQFVRELQTATRTIQT
LCSDAKVMKQTTITCKILIAKRSMERLLFRVKELLHSTSTGYTFWMD
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atggttcttctccagaacaaacaaatcggtcctcgtaaacgtccggcgaaatcaaaaact
ggattcgttactccgtttgctccgcccgcaaaaatccccaaattggcacctgctaatgag
gaaagtgttccgcaaaaaatagcttcccaatcggaagctgcaaatgaggaaaacgttccg
cgaaaaatagcttcccaatcggaagctgcaaatgaggaaagtgttccgcaaaaaatagct
tcccaaccggaattggaatcagaagcgtcaaatttaaggcagtcgcaaattgtaagtgcg
actgagaaaatgatttcggttctagcagatgccggttgtacactgattaatcccttgggt
ccgccttgtttaccgtctgacctacataagcttcggaacaagctccagagtgttttatca
tctgattcatctcgaaagtctgagttcctccaaggtctctcgagttacgttaattctcac
agcaaccttcgccgcattttatcaccttcaagacgtgatgggcttggatcgctacgaagt
gacagcctggcaagagtactgcttctggttccttccgtccaatcagacattcaaaacttg
ctgcttgaaaagcttcctgagtattttgatgtggaccccgctggaagtatcggagggaga
tcatcctctttatgtattgaagaagacatagcaaggctgattctgaaccaattccggtgg
cttgacttccttgtggattcagaagcatttacagaaaaactgttacaagtgttatctatt
tcccccgttcatttgaagaaggagataattgggtccttgcccgagattattggggagaaa
aacaacaaaactgtcatagattcgcttcaggacatgcttcaagaggattcttccattatc
gttcccatgcttgattgtttctctaacctccatttggatgatatgttgcaagaccaggtc
attacagtggctttgtcttgtatctgaactattgatgcggagcatattccctacctattg
agattcttactgcttctggctacgccaaccaatattcgtaggattatttcacacatccga
catcaactcaaacttgttggagcatcgaatgtttggaccacacaacagagtaagatgaag
ggaaagtcagtcgtcaacaatgaagaagcttcaatacttgatgccttgcgaacaagtctt
cgatttttaataaattgttggtaggtaatttgccaagaaacattgaatgaactgaaaagc
cttgagaaagttcaggatcataaggtgattgacatatggttgctcatgcttatatacatg
aacaacgagcctttacaaaagattgttgagaaattactgaagaagaaaattcttgaggga
tgtattgtggaaactatgtttgatcaatgtgtttctgggaatacagatttggctcgggat
tatcttcctaccctcctttccatttctgagtacttactggcttgcaaagaagataaagcc
cgggaattcggcattcacatgtacacaaatctgttcaaagagcttgtggatagttactca
agacaggaagtccttggaacattaattactcacgtgggctctgggataagtcatgaagtg
agttctgctatggatgtgatggtcctccttgcttcgaagtactcacaggagttggttcca
ctttcttctcatataactggcatcctagattacttggaggcatttagtgttgaaaacctg
cataaggtatatgaaaccttcagtcttctggcattttctgctgaagtgactgcagggccc
tttggatctcctatttcaaatgaactactagtgattgtgagaaagcagctgagtcatcct
gatcttatttataagaagatgggcttaattggcactcttaagatagtctcctacctcggg
gatgcaaaaactacgaagcttcttccatcatctatgtcaaattacgaggaagctttggag
ctcttggaaacatctatgaactcttgcaaaaagctgccacttccgttaattatgttttat
gatgagctggcttttacattgaagaaaaaagcacttcatccagccatagtcgaatggaca
agcaaacacgttggggactttgaaacaaagtttttgtgtgacctcgatggtggggtgctt
atggtcaaagagttatattgtgggttggaaggagatttatggatgaacctcgacggagac
atatctcctatatgtctcaacatcttgccacttgtatcctcttctttgcgggctgcttca
tcactgcaaattcttcctgcaaactttgttttgctatcttcaattgaggggttggcaaat
caaggatctcttgcaggaattgatgctcttcttggctgccctatacaccttccttcctct
aagttcttctgtgaaatgctttggggctctttaagtggaaagcaaaagcaaatcattatt
ctatcattgtactatgctgccaattggctgcgggaactgctcaatgccttttgtactcaa
gctgtcgatgagtttaatgcagccagtcaagcaacaagagaggagataactcttaaacta
tttaagcggttgaggaatcttgtatttttggagagcttgctaaacagttcctcaaacagt
gctctctttccttacctgcactccaacctcatctggagtccttgtcgctaccaacttgat
cataatagaaatcaggagatgaagaatgagaatggtaatggtaatattggtccatcacaa
aagaggaagaaagagaagaagagcagccaaatatcacttactgatggaaaatttaggcag
ccaaccatcatggatgctttgaggaaagcaggtgcgattccaagccaggaaccaagtacg
ggtccttctggaatgtgttcaaaaggcagcgcatctgagccatcaaggaatcaacaatgc
aatattaatatgtcagcgaacgtagatgtttctaccgctgtggatcatgtcgaagcacaa
agacacaagttcaggcctcttttgttggattgctttactatcttaacttttcagaagact
cagcattcctgttgtgcagatccagctgctgagttgcccctttgtctatatattctgagg
gatctaaacagaaagctggactactttaatccatgaaggcatatattggttaggcacatg
agtgttcctcttgcttttggtgagatgaaagtaatagagttcataagcaaaattcagcca
ctatttccttcccttagaaggcatttggattctgcagtatctggtcttagagaagataca
gacacatgcccagatcattggagaactcattctgcctttgctggaaatcctgatataccc
aacgttacaagctttagaccatcagcttctagatctgtcataaaagagacacttcaatgc
ttcggcaaggcattaaacattccggatgttcagagagacaggtcagtactttctgatctt
ctggaggcattccagccaatcagcatttcagactgctttttcaaaggcatgcagttgatt
ccatcactaggagatatcgcttatttgtatgctggtgcatattcatttgttgggaatatc
tttgatgcagcctgtgctgtctcatttgctttagcttccgaagtattgttaagcttggaa
tcaatgcttgtgtctttccgaactgtcctaggtaacaatctcaacgatattgggaaagat
attcgcacaggtttttcaaaagagctatcttcttttctgtccaagaagctgggaactttt
gcttacaaacttttgatgcaaaagagttatggtgttaatgacactgaagatggtcagaaa
gtcaaagcggaggtcattcaaaagcttttacgaatttacttggaaaatagccagtccact
tccgattccctaagtgaacttgcctgctctgttttgccccaggtttcatcacgcagatct
gcagtggaggatggctgttgttttcctactctctgtcctgcaacattttgcatttggtac
agggtactgcatgaagagaaccttgccatgatacgcttggtaaaggaaattttacttctg
gagaaagccaggggtggtggtgaagtggaagaagtcaaatgccttctgaagaaactacaa
caatctgttaatgtggctgtatctttagtcaatttgtgcaagacccatgataaggtcaat
gtacgtgcaatagctgtcaagtttggtgggaagtttgttgactctttcctcaaagctttt
ggcttcttgcaggggcaatttgttagagagcttcagacggcgacgagaactatccagaca
ctatgttcagacgcaaaggtcatgaaacaaacaacaataacctgcaaaatcctcattgcc
aagagatctatggagcgattgttatttcgtgttaaggaacttcttcactcaacgtcaact
ggatacactttttggatggattaa

DBGET integrated database retrieval system