KEGG   Capsicum annuum: 107879482Help
Entry
107879482         CDS       T04646                                 

Definition
(RefSeq) aspartate--tRNA ligase, chloroplastic/mitochondrial-like
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
cann  Capsicum annuum
Pathway
cann00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    107879482
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cann01007]
    107879482
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:cann03016]
    107879482
   03029 Mitochondrial biogenesis [BR:cann03029]
    107879482
Enzymes [BR:cann01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     107879482
Amino acid related enzymes [BR:cann01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   107879482
Transfer RNA biogenesis [BR:cann03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    107879482
 Prokaryotic Type
   Other AARSs
    107879482
Mitochondrial biogenesis [BR:cann03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    107879482
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon tRNA-synt_2
Motif
Other DBs
NCBI-GeneID: 107879482
NCBI-ProteinID: XP_016582002
UniProt: A0A1U8HF04
Position
8
AA seq 208 aa AA seqDB search
MTFKIEGLFSCIPFYFFNFHINSRPTSLVINPPRRPLSSSSSTSVVVTDNRIPLSPPPNT
TDALQWVSRNQYCGELTENDVGKRVRLCGWVALHRIHGGLTFINLRDQTGIVQITTLPDD
FPDAHSTMNGLRLEYVVAIEGVVRPRPAESVNKKMKTGTIEMSSNIILLNRVVKLLRRYL
EDVHDFVEIETPILSTSSPEGARDYLVP
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgaccttcaagattgagggccttttttcttgtatacctttctactttttcaatttccac
attaacagccgccccacttcacttgtcatcaaccctcctcgtcgtcctctttcttcttct
tcttctacttcagttgtagtcactgacaacagaattcctctatctcctcctcctaacact
actgatgcgcttcaatgggtaagtaggaatcaatactgcggtgaattgacagaaaatgat
gtgggtaaacgggtaaggctttgtgggtgggtcgcccttcatcggattcatgggggtctt
actttcatcaacctcagagaccaaactggaattgttcagattactacacttcctgatgat
ttccctgatgctcattctactatgaacggtctgagacttgaatacgtggttgccattgaa
ggtgttgttcggcctaggccagctgagtctgtcaacaaaaagatgaaaactggcacgata
gagatgagctcaaatataatcttgctcaatagagtagtgaaacttcttcgaagataccta
gaagatgtgcatgattttgttgagattgagacaccaatactatctacatctagtcctgaa
ggtgctcgtgattatttggttccttaa

DBGET integrated database retrieval system