KEGG   Cellulophaga algicola: Celal_0028Help
Entry
Celal_0028        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Homeobox
Motif
Other DBs
NCBI-ProteinID: ADV47386
UniProt: E6X686
Position
complement(31434..31904)
Genome map
AA seq 156 aa AA seqDB search
MKYTRLTKQQLEELHQEFINFLATQSITGEEWEKIKTDTPEVAEEELDVFSDLVWEGVLN
KVDFVENISAQQMHLFHLTEKEMKLISVKVMNPEIDLTTEIGFNWFKKNWQSDFVEYLSA
SKAYKDDKNLDKFELIKKGAVITKGELYQWFEKVIG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaagtatacaagacttacaaagcaacagttagaagaattacatcaggaattcattaat
ttcttagccacacaatctatcacaggagaggagtgggaaaaaattaaaacagatacacct
gaagtagcggaagaagaattagatgtattctcagatttagtttgggagggtgttttaaat
aaagtagattttgtggagaatatttcagcgcaacaaatgcatttgtttcatttaacagaa
aaagagatgaaattaatctctgttaaggtgatgaatcctgagatagacttaacaacagaa
ataggttttaattggtttaagaaaaactggcaatcagattttgtagaatatctttcagca
tctaaggcttataaggacgataagaaccttgataaatttgaacttataaaaaaaggtgct
gtgattacaaaaggagagttgtaccaatggtttgaaaaagtcataggataa

DBGET integrated database retrieval system