KEGG   Cellulophaga algicola: Celal_0032Help
Entry
Celal_0032        CDS       T01404                                 

Definition
(GenBank) SSU ribosomal protein S6P
  KO
K02990  small subunit ribosomal protein S6
Organism
cao  Cellulophaga algicola
Pathway
cao03010  Ribosome
Module
cao_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:cao00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Celal_0032
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:cao03011]
    Celal_0032
   03029 Mitochondrial biogenesis [BR:cao03029]
    Celal_0032
Ribosome [BR:cao03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Small subunit
    Celal_0032
  Bacteria
    Celal_0032
Mitochondrial biogenesis [BR:cao03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Celal_0032
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_S6
Motif
Other DBs
NCBI-ProteinID: ADV47390
UniProt: E6X690
Position
complement(36062..36400)
Genome map
AA seq 112 aa AA seqDB search
MNHYETVFILNPVLSDTQIEETVKKFEDFLISKDAKMVSKENWGLKKLAYPIQHKKSGFY
HLFEFSSTGEVVSPFELEFRRDERIMRFLTVKLDKHAISWAERRRTKLKTKA
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaatcattacgaaactgttttcattttgaatcccgttctatctgatactcagatagag
gaaacagttaagaaatttgaagatttcttaattagcaaagatgccaaaatggtatctaaa
gaaaattggggcctaaaaaaattggcttatccaatacaacacaagaaaagtggtttttac
catttgtttgaatttagttctacaggagaagttgtttccccttttgaattagaattcaga
agagatgagcgtatcatgcgtttcttgactgtaaagttagacaagcatgctatttcatgg
gcagaaagaagaagaacaaagttaaaaactaaagcttaa

DBGET integrated database retrieval system