KEGG   Cellulophaga algicola: Celal_0034Help
Entry
Celal_0034        CDS       T01404                                 

Definition
(GenBank) primosomal protein N'
  KO
K04066  primosomal protein N' (replication factor Y) (superfamily II helicase) [EC:3.6.4.-]
Organism
cao  Cellulophaga algicola
Pathway
cao03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:cao00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Celal_0034
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cao03400]
    Celal_0034
Enzymes [BR:cao01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Celal_0034
DNA repair and recombination proteins [BR:cao03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Celal_0034
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD ResIII Helicase_C zinc-ribbons_6 Stc1 zinc_ribbon_12 Cript
Motif
Other DBs
NCBI-ProteinID: ADV47392
UniProt: E6X692
Position
complement(37339..39795)
Genome map
AA seq 818 aa AA seqDB search
MSYFINVILPIPLEKLFTYSISEAEADFLQPGMRVAVPFGKSKIYTALVHEVHQTPPAVY
DAKEIHQILDEIPLVTATQLKHWFWIAEYYMCSVGEVFRSAVPNAFLLESETLILKNKNF
NADENELLDDEFLVFEALEHQSILRVQEISAILEKKNILPVLNRLLDKNIIILKEEVYEQ
YKPKMVRYVRMGKAYLSEEKLEELLTTLTRAPKQSQVVLTLFQLQATTKKPIKVSELEVA
SKSSAAIIKTLIDKAILEEYFVQTDRVVYVEDGDNESLKSLNEYQEEALKDIRIGFDKKL
PTLLHGVTSSGKTEVYVKLIEECIRSNKQALYLLPEIALTTQLISRLQEYFGEKVAVYHS
KYSVQERVEVWNNVLANKAKAQIVIGARSALFMPFADLGLVIIDEEHESSFKQYDPAPRY
HARDTAIVLGKLHKAKILLGSATPSVESYYNAQSGKYGYASILRRFGNVLMPDIELVDIK
ELTRKKRMKGHFSERLLEEIKETLENGEQVILFQNRRGYAPIMECTTCGHSPQCPNCDVS
LTYHQHKKQLRCHYCSYNIAVPLACEACGSATLDTKGFGTEQVEQELNNLFPDVKVGRMD
LDTTRGKYGYEKIITAFEQQEIDILVGTQMLTKGLDFRNVNLVGIMNADTLLNFPDFRAH
ERSYQLLTQVSGRAGRTKKRGKVIIQSYNPYHQILKQVSTGDYEGMFKEQLYERQQYKYP
PINRIIKITFKHKDYNKLNEAAEWFTKGLRNAFGIHVLGPEFPPVSRIRNQYLKNVLIKI
PNGQALGKTKNSIKRIEKSFNAISQYASVRVIYNVDYI
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgtcttattttatcaatgtaattcttcctataccgttagaaaaactgtttacatacagt
atttctgaagcagaagcagattttttgcaaccaggaatgcgagtagcagttccatttgga
aaatctaaaatatataccgctctggtgcatgaggtgcaccaaacaccaccagcagtctat
gacgccaaagaaattcatcaaatattagatgaaattcctttagtaactgccacgcaatta
aaacattggttctggattgcggagtattatatgtgtagtgtaggtgaagtttttagatct
gctgtgcctaatgcctttttattagaaagtgaaacattaattctaaagaataagaatttt
aatgcagatgaaaatgagcttttagatgacgaattcttggtgttcgaagctttagaacat
caatctatactacgcgtacaagaaataagtgccattttagaaaaaaagaatatactcccg
gtattaaatagactcttagacaaaaacattatcatcctaaaagaagaagtgtacgagcag
tataagccaaaaatggtgcgttatgttcgtatggggaaggcatatctatccgaagaaaaa
cttgaggaattgttaactaccttgacaagagctcccaaacaaagtcaagttgttttaaca
ttatttcaattgcaagccacaacaaaaaagcctattaaagtttctgagttggaagtggca
agtaaaagttctgcggctataataaaaacccttattgataaagctattctcgaagagtat
tttgtacaaacagatagagtggtttatgtagaagatggagataatgaaagtctaaaatca
ttaaacgagtatcaggaagaggccttaaaagatattagaatagggtttgataaaaagcta
cctactttattacatggagtaacttcttcagggaaaacagaggtttatgttaaattgatt
gaagagtgtattcgttcaaataaacaagctttatatctattgcctgaaattgcattaact
acgcagttaatttcaaggctacaggaatattttggagaaaaagtagcagtatatcattct
aagtacagtgttcaggagcgtgtagaagtttggaataatgttttagcaaataaagcaaaa
gcacaaatagtgattggagcaagatctgcattatttatgcctttcgcagacttaggttta
gttattattgatgaagagcatgagagttcatttaagcaatatgatcctgcgccacgttac
catgcacgagatacagctattgttttagggaaattacataaggctaaaattttattgggg
tccgcaacacctagtgtagaaagttattacaatgcacagtctggtaaatatggctatgcc
agtattctacgaagatttggcaatgttctaatgccagatattgaattggttgatattaag
gagttgactaggaaaaagagaatgaaaggtcatttctccgagcgattattggaggagatt
aaggaaactttagaaaacggggagcaagtaattttatttcaaaatagaagagggtacgcc
cctattatggaatgtactacttgcggacactctcctcaatgccctaattgtgatgttagt
ttaacgtatcatcaacataaaaagcaattgcgttgtcattattgtagttacaatatagca
gtgcctttagcttgtgaggcatgcgggagtgctacgctagatactaaaggttttggaaca
gaacaagtagaacaagaattgaataacttatttcctgatgtaaaagttggtcgtatggat
ctagatacgacacgaggaaaatatggctacgaaaaaattattacggcatttgagcagcaa
gagatagacattttagtaggtacacaaatgcttacgaaaggattagattttagaaatgta
aatctagtaggaattatgaatgcagatacgttgctaaattttccagattttagagctcat
gaacgcagctatcaattgcttactcaggtatcgggtagggcagggcgaacaaaaaagcga
ggtaaagtaattattcagagctacaacccataccaccaaatattaaaacaagtatctact
ggtgattatgaagggatgtttaaggagcagttgtatgaaaggcaacagtataaatatcca
ccaataaatcgcattattaaaataacgtttaagcataaagattataacaaacttaatgaa
gcggcagaatggtttacaaaagggttgcgaaatgcatttggtatccatgtcttagggcca
gagtttcctccggtgtctagaattagaaaccaatacttaaaaaatgttttgataaagata
cctaatggtcaagctttgggtaaaactaaaaatagcattaaaagaattgaaaaatctttt
aatgctatttcgcagtacgctagcgtacgtgtaatctacaatgtagattatatatag

DBGET integrated database retrieval system