KEGG   Cellulophaga algicola: Celal_0039Help
Entry
Celal_0039        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PilJ
Motif
Other DBs
NCBI-ProteinID: ADV47397
UniProt: E6X697
Position
complement(42657..43505)
Genome map
AA seq 282 aa AA seqDB search
MKKFYKYYLLVSTIIILTVLIQSIIQYSLRNQERMAAVINVAGKQRMFSQLVLKDFYECK
DYDCNYSELKVALAKLYRTDEVLQNGDEKLGFYPVENPEIIADFKKLQPHLDYIYANLNA
TDRIAEVSVIELSGHVDSFLKIMDGIVLKFQQESEEEIKTIMIIEVELAVLSLFIILFEI
VYIVNPIIRKTTSQNQKLKEISWHQSHAYASHMKNIKDLQHVLKIERKIENKEDLVACVI
TELDALNEVSENMLKSLESDEEEISKLDILLTKLDKLFDRKK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaattttataaatattatttattagtcagtacgattatcattttaacggtttta
attcaatcaattattcagtattctttaagaaaccaggaacgtatggcggctgtcattaat
gttgcgggtaaacaacgtatgtttagtcagttagtgttaaaagatttttatgaatgtaaa
gattatgactgtaattattcagaattaaaagtagccttggctaaattatatagaacagat
gaagttttacaaaacggagatgagaaacttggtttttatccggtagagaatcctgaaata
atagctgattttaaaaaattgcaaccgcatttagattatatctatgctaatttaaatgct
acagatcgtattgcagaagtttctgtaatagagctatctggtcatgtagatagttttcta
aaaattatggacggtattgttcttaagtttcaacaagaatcagaagaagaaataaaaacg
attatgatcatagaggtagagttagcggtcctgtcgctgtttattatcctttttgagata
gtttatattgtaaatcctattattagaaaaactacctctcagaaccaaaagcttaaagag
atttcgtggcatcaatctcatgcgtatgcttcgcacatgaaaaatataaaagatcttcag
catgtgctaaaaattgaacggaaaatagaaaataaagaagatttagtagcgtgcgttatt
acagagttagatgcacttaatgaagtatcagaaaacatgttaaagtctttagaaagtgac
gaggaagaaataagtaagttagatattcttctaactaaattagataaattatttgatagg
aaaaagtaa

DBGET integrated database retrieval system