KEGG   Cellulophaga algicola: Celal_0042Help
Entry
Celal_0042        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3307
Motif
Other DBs
NCBI-ProteinID: ADV47400
UniProt: E6X6A0
Position
complement(46526..47233)
Genome map
AA seq 235 aa AA seqDB search
MMLLTKLFLAHLLGDFIFQPSKWVKDKEEKKVKSKYIYYHTLIHFALSLLLLWDLKYWKI
AVVIAVSHYLIDLIKLYITPSFKNKSVPFFIDQAMHIAVLYGCVYYGDLVNHTVKLFQEI
DLNLVTAFVFVSFPAAIIISKLLQGMARHIEDDHESLPNAGMYIGIIERFFVLTFLIAGH
WEVIGFLIAAKSVFRFNDLKDSNSRELTEYILIGTLLSFGIAILTGIVYNTLLSI
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgatgttattgaccaaactatttttagcacatctgctaggagattttatttttcagccc
tctaaatgggttaaagataaagaagaaaaaaaagtaaaatctaaatacatctattatcat
acgttaattcattttgctttatcgttgctgttgttgtgggatttaaaatactggaaaatt
gcagtagtcattgcggtttctcattaccttatagatttaataaagctctacataacacca
agttttaaaaataaaagtgttccattttttatagatcaagcaatgcatattgccgtatta
tacgggtgtgtttattatggagatttagttaatcataccgtaaaattatttcaagaaata
gatcttaatttagttactgcttttgtatttgttagttttcctgccgccataataataagt
aaactattacagggaatggctaggcatatagaagatgatcatgaatcattgccaaatgca
ggaatgtatataggaataatagagcgtttttttgtgcttacgtttctaattgctggacat
tgggaagttataggttttttaatcgcggcaaaatctgtttttagattcaatgacttaaaa
gatagtaatagtagggaattaacagaatatatcttaataggaacgttgttgagttttggg
atagccattttaacaggcatagtgtataatacgcttttaagcatatga

DBGET integrated database retrieval system