KEGG   Cellulophaga algicola: Celal_0044Help
Entry
Celal_0044        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEMT DUF1295 ICMT ERG4_ERG24 YtpI
Motif
Other DBs
NCBI-ProteinID: ADV47402
UniProt: E6X6A2
Position
complement(47920..48372)
Genome map
AA seq 150 aa AA seqDB search
MYLKLPPAIVWLLAASLMLGVARFLPFGNFDFTGRIYFIYVFIGLGAFIGVFAIIQFIKK
HTTINPTKPQNVSQLVTAGLYSYSRNPMYLGLLLVLLAWGLYLGNAFNSLVAAGFVSYMN
AFQIKPEEAALSNSFGSEYKAYLKHVRRWF
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtatttaaaattaccgccagcgatcgtttggcttttagcagcatcacttatgttaggt
gttgctcgttttctaccattcggaaattttgattttacaggacgtatttattttatatat
gtttttataggattaggcgcttttataggggtatttgcaattattcaatttattaaaaag
catacgactattaaccctacaaaacctcaaaatgtttctcaattggtcaccgcaggattg
tatagttacagccgtaatcctatgtatttaggcttattgttagtgcttttggcttggggt
ttgtatttaggaaatgcttttaattctttagtggcggcagggtttgtatcttatatgaat
gcttttcagataaaaccagaagaagcggcactttctaatagttttggttcggagtataaa
gcctatttgaagcatgttagaagatggttttaa

DBGET integrated database retrieval system