KEGG   Cellulophaga algicola: Celal_0046Help
Entry
Celal_0046        CDS       T01404                                 

Definition
(GenBank) DEAD/DEAH box helicase domain protein
  KO
K05592  ATP-dependent RNA helicase DeaD [EC:3.6.4.13]
Organism
cao  Cellulophaga algicola
Pathway
cao03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:cao00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    Celal_0046
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:cao03019]
    Celal_0046
   03009 Ribosome biogenesis [BR:cao03009]
    Celal_0046
Enzymes [BR:cao01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     Celal_0046
Messenger RNA biogenesis [BR:cao03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Helicases
     Celal_0046
Ribosome biogenesis [BR:cao03009]
 Prokaryotic Type
  rRNA helicases
   Celal_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DEAD Helicase_C DbpA ResIII AAA_22
Motif
Other DBs
NCBI-ProteinID: ADV47404
UniProt: E6X6A4
Position
49223..51124
Genome map
AA seq 633 aa AA seqDB search
MTKFEALGLKKSILDAITDMGFETPSDVQEKAIPILLGDDTDLVALAQTGTGKTAAFGFP
LIQKIDADSRTTQGLILSPTRELCLQITNEMQSYSKYEKNINVVAIYGGASITDQARQIK
RGAQIIVATPGRMKDMMSRGLVDISKIDYCILDEADEMLNMGFFEDIKEILSDTPKEKST
WLFSATMPREVATIAKKFMRSPQEITVGAKNSGASTVQHEYYVVSGRDRYPALKRLADTN
PDIFSVIFCRTKRDTQKVAESLIEDGYNAGALHGDLSQNQRDLVMSSFRKKQIQILVATD
VAARGIDVDDITHVINYQLPDEIETYTHRSGRTGRAGKSGISMVIITRSELRKIKAIENK
IGQKFITKNIPTGMEICEIQLYHLANKIKDTEVNAEVETYLPAINKVFEGIDREELIKKV
VSVEFTRFFNYYNKTRDLATSSSGREERGERGERSNNSGEIPTDGSVRYFINVGEKDEYD
WMSLKDFLRDTLEVGQDDIYKVDVKESFSFFNTDAAITPKILETFKDFKVDGRFVNVEIS
SNPGGGGGRGGRDRNRSGGGGGGRDRNRGGGGGGDFKKRKSSSSRDGGYGGGSSEGGGSR
RRSDSSSGSKSGSRSGSRESSSGSKSKRRSGFF
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaatttgaagcgttaggccttaaaaagtctatattagacgctattacagacatg
ggatttgaaactccatctgacgtacaagagaaagcaattccaatcttattaggtgacgac
accgacttagtagctcttgcccaaacaggtacaggaaaaacagcagcatttggttttcca
ttaattcaaaaaatagatgcagatagtagaaccactcaaggtttaatattatcaccaaca
cgtgaactttgtttacagattacaaatgaaatgcaatcgtattctaaatacgaaaaaaac
attaatgttgtagctatatatggtggtgcaagtatcactgaccaagcaagacaaattaaa
cgtggtgcacaaattatcgtagcgactcctggtcgtatgaaagatatgatgagccgtgga
ttagttgatatctctaaaattgattattgtattttagatgaagctgatgaaatgcttaac
atgggattctttgaagatatcaaagaaattctttctgatactcctaaagaaaaaagtact
tggttattctctgcaacaatgcctagagaggtagctacaattgctaaaaagtttatgcgt
agtccacaagaaattactgtgggagctaaaaactcaggagcatcaacagtacaacatgaa
tactatgtagttagtggtcgtgatagataccctgcattaaaaagattagcagataccaat
ccagatattttctctgttatcttctgtagaactaaaagagatactcaaaaagtagccgaa
agtcttattgaagacggatataacgccggtgctttacacggagatttaagtcaaaaccaa
cgagatttggtaatgagttctttccgtaaaaaacaaatacaaatattagttgcaactgat
gttgctgcacgtggtattgatgttgatgacatcacacacgtaattaactatcaactacca
gatgaaatagaaacctatactcaccgtagtggtagaactggtagagctggaaaatctggt
atctcaatggtaattattaccagaagcgagcttagaaaaataaaagcaatagaaaataaa
attggtcaaaaattcatcacaaaaaatattcctacaggaatggaaatttgtgaaattcaa
ttataccacttagcaaataaaataaaagataccgaagttaacgctgaagttgaaacttat
ttacctgcaataaacaaagtatttgaaggtattgatcgtgaagagttaattaaaaaagta
gtttctgtagaatttactcgtttctttaattactacaacaaaacaagagatttagcaact
agcagctctggtagagaagaaagaggcgaaagaggcgaaagaagtaataacagcggagaa
atccctacagatggttctgtacgttactttataaacgttggtgaaaaagacgaatacgat
tggatgtctctaaaagatttcttgagagacactctagaagttggtcaggatgatatttat
aaagttgacgttaaggaaagtttttctttctttaatactgatgcagcaattacaccaaaa
attttagagacttttaaagactttaaagttgacggaagatttgtaaatgttgagatttct
agcaacccaggtggtggcggaggtcgtggaggaagagatcgtaaccgcagtggcggtggc
ggcggaggaagagatcgtaatcgcggtggcggtggcggaggagacttcaaaaaacgcaag
tcttcatcatcaagagatggtggttacggaggaggaagttctgaaggaggaggatctaga
agaagatctgattctagctcaggatctaaatctggttcacgtagtggaagtagagaatct
agtagcggtagcaaaagcaaacgtagaagtggctttttctag

DBGET integrated database retrieval system