KEGG   Cellulophaga algicola: Celal_0047Help
Entry
Celal_0047        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CarbopepD_reg_2 CarboxypepD_reg
Motif
Other DBs
NCBI-ProteinID: ADV47405
UniProt: E6X6A5
Position
51296..52081
Genome map
AA seq 261 aa AA seqDB search
MKNKLIYIFLFTCVAIGFSQETEQENQQNEFLKAIVINAQDGSLMESVHIVNLNQVVGTI
TNEKGEFTIPAIANDTLYFSYLGFKSQKVRVTNDMLKFKNTKITLTELAYALEEVIVTSY
DLTGYLEIDVKNLPLNDSYQYSISGLNTSYEAGKKNPSAVTKVLGAILNPADLLRNLFGK
KPNQMKKLRKVKEDDAIKDLLASKFDRETLTELLHIEKVDIEDILNNCNYSKSFIATAND
LQILDAISGCYEDYKVLNRKQ
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacaagcttatttatatatttctatttacctgtgttgccataggattctctcaa
gaaactgagcaagaaaatcaacaaaacgaattcctaaaagcaattgtgataaatgcacaa
gacggttctttaatggaaagcgttcatattgtaaacctaaaccaagtagttggtactata
accaatgaaaaaggggagtttaccatccctgcaatagctaatgacaccttatattttagc
tatttaggttttaaatctcagaaagtccgcgtcaccaatgatatgctgaagtttaagaac
acaaaaattaccttaacagaacttgcatacgcccttgaagaagtaattgttacgtcatac
gatctaactggttatttggaaatcgatgttaaaaatttacctttaaatgattcttaccag
tacagtatctcaggattaaatacaagctatgaagcaggtaaaaaaaatccgagtgccgta
accaaagttttaggtgccattcttaatcctgcagatttattgcgaaacttatttggaaaa
aagccgaaccagatgaagaagcttagaaaagttaaagaagatgacgccattaaagattta
ttagcctctaaatttgatagagagacactcacagagctactacatatagaaaaagtagat
attgaagatatcttaaacaattgtaattattcaaaatcatttattgctactgccaatgac
ttacaaattttagatgccatcagtgggtgttatgaagattacaaagttttaaaccgtaag
caatag

DBGET integrated database retrieval system