KEGG   Cellulophaga algicola: Celal_0051Help
Entry
Celal_0051        CDS       T01404                                 

Definition
(GenBank) NAD-dependent deacetylase
  KO
K12410  NAD-dependent deacetylase [EC:3.5.1.-]
Organism
cao  Cellulophaga algicola
Brite
KEGG Orthology (KO) [BR:cao00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Celal_0051
Enzymes [BR:cao01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.-  
     Celal_0051
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SIR2
Motif
Other DBs
NCBI-ProteinID: ADV47409
UniProt: E6X6A9
Position
55467..56168
Genome map
AA seq 233 aa AA seqDB search
MKKIVVLTGAGISAESGIQTFRDADGLWEGYDVMEVASPQGFINNPKLVLDFYNQRRKQL
LNVLPNNAHYALTALEKHFETTIITQNIDDLHERAGSSTVIHLHGELLKARSTKTSRIGS
PEIIDWKKDMKLGDKCINGHQLRPHIVWFGEAVPLLDKAIEITQDAAILIIIGTSMQVYP
AASLVNFVKNETPIYFIDPRPNITKNAFNNLNIIEKTAVEGLPELVAQLIKTY
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgttgttttaacaggagcaggtataagtgcagaaagtggcatacagact
tttagagatgcagatggcctatgggaaggctatgatgttatggaagttgcatcgccgcag
ggttttataaataacccaaaacttgttttagatttttacaaccaacgcagaaaacaactt
ctcaatgtattgcctaataatgcgcattatgcattaacagctcttgagaaacattttgag
accactatcattacccaaaatattgatgatctacatgaaagagcaggcagttcaacagtt
attcacctacatggagagttattaaaagcaagaagcactaagacctctagaattggaagc
cctgaaattatcgactggaaaaaagatatgaaactgggtgataaatgtataaacggacat
caactaagaccccatatagtttggtttggagaagctgtacccttacttgataaagcgata
gaaattacccaagatgcagctattttaattattattggaacctctatgcaagtatatccc
gcagctagtttagtgaattttgtaaaaaacgagacccctatttattttatagaccctaga
cctaatatcactaaaaatgcctttaacaatttaaacattatagaaaaaactgcggtagaa
ggactcccagaattggtagcacaactaattaaaacctattaa

DBGET integrated database retrieval system