KEGG   Cellulophaga algicola: Celal_0055Help
Entry
Celal_0055        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF4252 DUF4518
Motif
Other DBs
NCBI-ProteinID: ADV47413
UniProt: E6X6B3
Position
complement(59245..59784)
Genome map
AA seq 179 aa AA seqDB search
MKVIKRSLGIALVLLFFSCSSTQSLQEYYVDNAENPNFLSFDLPASLLNMNEVALTPEQK
KAFTSLKKLNVLAFKKTKDNGTAYVAEKATVKAILKNDKYQELMKLNTSYGKGSIKFSGD
EDAIDEVVIYGDSDDKGFMLIRVLGDNMNPANLMQLIQTLEKSNVDGKQLESLIGFFNK
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtaataaaacgtagtttaggaatagcattggtactgttgttttttagttgttca
tctacccaaagtcttcaagaatattatgtagataatgcagagaatcctaatttcctgtct
tttgatttgcctgctagtttattaaatatgaatgaggtagccttaacgccagagcaaaag
aaggcttttacgtctttaaagaagctaaatgtattggcatttaaaaaaacaaaagataat
ggaacagcatatgttgcagagaaagctacagtaaaagcaatattaaagaatgataagtat
caagagttaatgaagctgaatacaagttatggcaaaggttctataaaattttcaggtgat
gaagacgctatagatgaggttgtcatttatggagatagtgatgataaagggtttatgctt
attcgggttttaggagataatatgaaccctgctaatttaatgcagttaatccaaacatta
gaaaaatctaatgtagatggtaaacagttagaaagtctgatagggttttttaataaataa

DBGET integrated database retrieval system