KEGG   Cellulophaga algicola: Celal_0058Help
Entry
Celal_0058        CDS       T01404                                 

Definition
(GenBank) hypothetical protein
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CrgA FTA4 ETRAMP
Motif
Other DBs
NCBI-ProteinID: ADV47416
UniProt: E6X6B6
Position
complement(60981..61415)
Genome map
AA seq 144 aa AA seqDB search
MELDNINNILEKYFNAETTIAEEKALKEYFVNGAVKPEHEKYVPIFAHLTKAKEEKFTKQ
IPLKKKKTNTKWFSVAAVAMLLFGLYLGNNYLQQKRIEKEQAAYAYQETKKALNLLAQNF
NKGKEKMAYLEEFEQTKQKIYNDN
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggaattggataatataaataacatactagagaaatattttaatgcagaaacaactata
gcagaagagaaagcattaaaagaatactttgtaaatggtgccgtaaagcctgagcatgag
aaatatgtaccaatctttgcgcatctaacaaaagcgaaagaagagaagtttaccaagcaa
attcctttaaaaaagaaaaaaacaaatacgaaatggttttctgtagcggctgtagcaatg
ttgttatttggtttgtatttaggtaataattacctacaacaaaagcgtatagaaaaagaa
caggcggcgtatgcgtaccaggaaacaaaaaaagctttgaatttattagcacaaaatttt
aataaaggaaaagagaagatggcctatttagaagagtttgaacaaacaaaacagaaaatt
tataacgataattaa

DBGET integrated database retrieval system