KEGG   Cellulophaga algicola: Celal_0059Help
Entry
Celal_0059        CDS       T01404                                 

Definition
(GenBank) RNA polymerase, sigma-24 subunit, ECF subfamily
  KO
K03088  RNA polymerase sigma-70 factor, ECF subfamily
Organism
cao  Cellulophaga algicola
Brite
Transcription machinery [BR:cao03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     Celal_0059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4_2 Sigma70_r2 Sigma70_r4 Sigma70_ECF DUF134 MCM_N
Motif
Other DBs
NCBI-ProteinID: ADV47417
UniProt: E6X6B7
Position
complement(61402..61911)
Genome map
AA seq 169 aa AA seqDB search
MKQVEFLNVVMPFKDKLFRLAKRLLVSTEEAEDATQEILLKLWTKNAAIEDYKNVEAFAM
TMTKNFCLDRLKSKQAGNLKLVHSNYKDENTSLQRQVEANDSVSWVEKIMEELPEQQKLV
LQLRDVEEYDYDEIAKMLDMQPTAIRVALSRARKTVREKLVEKHSYGIG
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaggtagaatttttaaatgttgtgatgccttttaaagacaaactctttcggtta
gccaaaagattgttggtatccacagaggaagcagaggatgcaactcaagaaatattactg
aagttatggacaaaaaatgctgctattgaagactataaaaatgtagaagcttttgccatg
accatgactaagaatttttgtttagaccgactaaagtcgaaacaagcagggaatctgaag
ttagtacatagtaattataaagatgaaaatacatcattacagcggcaagtagaagccaat
gatagtgtctcatgggtagaaaaaataatggaagaattaccagaacaacaaaaactggta
ttacaattgcgagatgtagaagaatatgattatgatgagatagctaaaatgttagatatg
caacccaccgcaatacgtgtagcattatcaagagctagaaaaacagtaagagaaaaatta
gtagaaaaacacagttatggaattggataa

DBGET integrated database retrieval system