KEGG   Cellulophaga algicola: Celal_0060Help
Entry
Celal_0060        CDS       T01404                                 

Definition
(GenBank) peptidase S41
Organism
cao  Cellulophaga algicola
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S41 PDZ_2
Motif
Other DBs
NCBI-ProteinID: ADV47418
UniProt: E6X6B8
Position
62140..63609
Genome map
AA seq 489 aa AA seqDB search
MFLGLGLFTISCSDKDDEPSEVVTIELNSEVNDFVWKAMNYWYYWQPEQVVLADDRFATT
DEFYSFLNGYNAPEDLYDAVKSPQDRFSFISDDYDNLISALGGTSTTTGIEFTLTRLPSD
NGNGVLGTVRYVWANSDAATKGIKRGDIFYGVNGTELFADTNSDGAITSSNLDLLNASTF
TLNFGIIENELFTPNNVNIEVNRLEITENPILIAKTLEVNATKIGYIMYNGFTSNNEDII
DDAFAKIKTEGATELVIDLRYNPGGATGVANRIAARITGQFAGQPFIEYIYNSKRNERFG
TTDPFESDYENTPLTSLGLTKVYVITTGDTASASELLINNLKPYITVVQVGETTVGKNEF
SITLLDNTAQTSNGYPPYAYYAQNVGLDGVNPNHKYALQPICGTYANADGFNDFASGLQP
DIAIDETLGNLGQLGDLEEPLLAKAIEDITGVTSKSLKSVVPESMKTEFVGSSLRLKKYN
NMVLIRDFN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
ttgtttttaggcttaggcctatttactatttcctgttctgataaagatgatgaaccttct
gaagtagttacgatagaattgaatagtgaggtgaatgattttgtttggaaagcaatgaat
tattggtattattggcaacctgaacaagtagtacttgctgacgatagatttgctacgact
gatgagttttatagctttttaaatggatataacgctccagaagatttgtatgatgctgta
aaatcaccgcaggataggtttagctttatttcggacgattatgataatttaattagcgcc
ttaggagggacctctaccactactggaattgaatttacattaacaaggctcccttctgat
aatggaaacggagtattaggaacagttcgctatgtttgggccaattctgatgctgcaacc
aaaggcattaaaagaggtgatattttctacggcgtaaacggcacagaactatttgctgat
acaaattctgatggcgctataacgtccagtaatttagatttactaaatgctagtacattt
actttaaactttggaatcatagaaaatgaactatttacaccaaataatgtaaatatagaa
gtgaatcgcttagaaattacagaaaaccctattttgatagctaaaactttagaggtaaat
gccacaaaaattggctatataatgtataatggtttcactagcaataatgaagatattatt
gatgatgcgtttgctaaaataaaaactgaaggcgcaacggaattggttatagatcttaga
tacaatcctggaggagcaacaggagtagctaatagaatagcggccagaattacagggcaa
tttgcaggacaaccttttattgaatacatctataattctaaaagaaatgaaagatttgga
actacagatccttttgaatctgattatgaaaatactccattaacaagtttaggtctaacg
aaggtatatgttatcactactggtgataccgcttctgctagtgagttgctaattaataat
ttaaagccatacattaccgtagttcaggtgggtgaaaccaccgttggtaaaaatgaattt
tctataacacttttagataatacagcacaaacatcaaatggttatcctccatatgcatat
tatgcccaaaatgttggtttagatggcgtaaatcctaatcacaaatatgcattacaacct
atatgtggtacgtatgcaaatgcagatggatttaatgattttgcatctggtctacaacca
gatattgctatagatgaaaccttaggaaacttaggtcagttaggtgatctagaagagcct
ttactagccaaagcaatagaagatattactggagttacaagtaagagtttaaaaagtgtt
gttcctgaaagtatgaaaactgaatttgtcggtagttctttaaggctaaaaaaatataat
aatatggtgttgatccgagattttaattaa

DBGET integrated database retrieval system