KEGG   Cellulophaga algicola: Celal_0063Help
Entry
Celal_0063        CDS       T01404                                 

Definition
(GenBank) TonB-dependent receptor plug
  KO
K16092  vitamin B12 transporter
Organism
cao  Cellulophaga algicola
Brite
KEGG Orthology (KO) [BR:cao00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cao02000]
    Celal_0063
Transporters [BR:cao02000]
 Other Transporters
  Pores ion channels [TC:1]
   Celal_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TonB_dep_Rec Plug
Motif
Other DBs
NCBI-ProteinID: ADV47421
UniProt: E6X6C1
Position
complement(65710..67569)
Genome map
AA seq 619 aa AA seqDB search
MNKQFLSLCAIALAYTSAAAQEQPNDSMKLQKLDEVVISDSRFELKRENSGKTVIKITSE
ELLQSQGKTVAEIINTKSGIEINGSRGRDGAVLGVSARGGRGKQVLVVIDGVRVSNPSSP
SSEYDLRLLATANIESIEIIKGAASTLYGTNAATAVINITTKKASDKAISGNFQTSLGTQ
QTADDQNYNLSTFSNSALVSGTLNKFDYAVGFSNRYSNGLSAFVNSADEKDFFSEYNTDI
KIGYKFSDKFNVRVYGNQTKISTAYDESFGTVADPRYKNNQERVGLSSSFLYNENGSVNI
NAAYSNYDAEDMGSYPGAFKGNNYTVDVYNKYNFNDTFYTILGVNYIQDESEFSELKKIT
ITDPYANLVYISPFGLNINAGARYNNNSEYGSHVVYNINPSYSYKLDNGYVKVLSSYATS
YITPSLSQLFGFFGANPELNPEENSTIEGGVEYANDKVRLSAVYFNRDENETIIYGSEGY
ENIEGFIKAQGVEVELDWNLCENLTWNANYTFTERKGDNAIRIPKHKVNTSFNYQISDAT
FASLSYAYTGDRSDTDFSTFSDVSLDPFSLVNFYVSHQLINNKLRIFANAQNLLNEEFVE
TVGYTTLGRNFSLGLNLNL
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaacaatttttaagtttatgtgctattgctttagcatatacaagtgcagctgct
caagaacagccaaacgattcgatgaaacttcaaaagttagatgaagttgtaattagtgac
tcacgctttgagttaaaacgtgagaactcaggaaagacagttattaaaataacttcagaa
gaattacttcaaagccaaggtaaaactgtagcagaaattatcaatactaaaagtggtatt
gaaattaatggtagtagaggtagagacggagccgttctaggtgtttctgctagaggtggt
cgtggtaaacaagttttagttgttatagatggtgttcgcgtatcaaacccttcttcccct
tcttccgagtatgatttaaggttattagcaacagcaaatatagaatctattgaaattatt
aaaggcgcagcaagtacactttatggtaccaatgctgctactgcagtaatcaatataact
acaaagaaagcatcagacaaagctatctctggtaactttcaaacaagtttaggtacacag
caaacagcagatgaccaaaattacaatctgtctacattttcaaatagtgccttggttagt
ggaactttaaataagtttgattatgccgtaggtttttctaatcgctattcaaacggactt
tctgcttttgtaaattctgcggatgaaaaagatttcttttcagagtataatacagatata
aaaattggatacaagttttctgataagtttaatgtgcgtgtttatggtaatcagaccaaa
ataagtacagcgtatgatgagtctttcggaaccgttgcagatcctaggtataaaaataat
caagaaagagtagggctgtcttcttcattcctatataacgaaaatggttctgtgaatata
aatgctgcctattctaattatgatgcagaagacatggggtcttaccctggagcatttaaa
ggaaataattatacagtagatgtgtataacaagtataattttaacgatacattttatact
attttaggagtaaattatattcaagatgaatctgagttttcagaacttaaaaaaataacg
attacagatccttatgctaatcttgtttatatttctcctttcggtttaaatataaatgca
ggagctcgttataataacaattcggaatatggttctcatgtagtgtataacataaaccca
tcgtacagttataaattggataatggatatgtcaaagtattatcttcgtatgcaacatcg
tacattacaccatcacttagtcagttatttggtttttttggtgctaatccggagttaaat
ccagaagagaattctaccattgaaggtggtgtagaatatgccaatgataaagtaagattg
agtgccgtgtattttaatagagatgaaaatgaaactattatttacggaagtgaagggtac
gaaaatatagagggtttcataaaagcacaaggggtagaggttgagttggattggaactta
tgtgaaaatttaacttggaatgctaattacacttttacagaacgtaagggagataacgca
atacgtattccaaagcataaagtaaatacatcatttaactatcaaatttctgatgcaact
tttgcttcgttaagttatgcgtatacaggagatcgttcagatacagattttagtactttt
tctgatgttagtttagatccattttctttggtgaatttttatgtaagccatcaacttata
aataataaattgagaatttttgcaaatgctcaaaacttattgaacgaagaatttgttgaa
acagtaggatatactactttgggtagaaactttagtttaggacttaatttgaatttatag

DBGET integrated database retrieval system