KEGG   Cellulophaga algicola: Celal_0065Help
Entry
Celal_0065        CDS       T01404                                 

Definition
(GenBank) periplasmic binding protein
  KO
K02016  iron complex transport system substrate-binding protein
Organism
cao  Cellulophaga algicola
Pathway
cao02010  ABC transporters
Module
cao_M00240  Iron complex transport system
Brite
KEGG Orthology (KO) [BR:cao00001]
 Environmental Information Processing
  Membrane transport
   02010 ABC transporters
    Celal_0065
Transporters [BR:cao02000]
 ABC Transporters, Prokaryotic Type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Iron complex transporter [MD:M00240]
    Celal_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_2
Motif
Other DBs
NCBI-ProteinID: ADV47423
UniProt: E6X6C3
Position
68066..69253
Genome map
AA seq 395 aa AA seqDB search
MTFATLQNIIYSKSMKYFFLFISILLFSCKEETKKIPDFVEKIIPSTDILYAKGFSVEKQ
PSGVTIIKITSPWPNAEAVFTYALIPKEKAASMTLNRDEYDAIVTVPIENIVVTSTTHIP
VLEALGVENTLVGFPDTQYISSNKTRALIAKGQIKELGQNETINTELLLELQPNLVVGFS
IHNENKMYETIQRANIPVVYNGDWTEETPLGKAEWIKFFAPFYGLEKKADSIFQDITNNY
LAAKELAAKATNRPTVISGAIYNDVWYLPGGKSWASKFIEDANAAYMFKDTEETGSLSLS
WESVLEKGKKANFWISPSQFTSYKDMTANSQHYGQFDAFKKKKVYSFAGTTGETGGLLYY
ELAPNRPDLVLKDLIHIFHPDLLPNYIPTFFKPLD
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacttttgctaccttgcaaaacattatatactcaaaatcaatgaaatacttttttcta
tttatatctattctactcttttcctgtaaagaggaaacaaaaaaaatacctgattttgta
gaaaaaataattccaagcactgatatattatatgccaaaggattttctgtagaaaaacaa
cccagtggagtaaccataatcaaaattacatcgccttggccaaatgcagaagctgttttc
acatacgctttaatcccaaaagaaaaagcggcatctatgactttaaacagagatgaatat
gatgctattgtcaccgttcctatagagaatattgtggtaacgtctaccactcacattcct
gttttagaggccttaggggttgaaaacaccttagtaggtttccctgatactcaatatatt
tcatcaaataaaaccagagcattaattgcgaaagggcagattaaagaattaggtcagaat
gaaaccataaatacagaactccttttagaattacaaccaaacttagtcgttggctttagt
attcataatgaaaataaaatgtacgaaaccattcaacgtgctaatattcctgtggtgtat
aatggtgattggaccgaagaaacacccttagggaaagcagaatggattaaatttttcgcc
cctttttatggtttagaaaagaaagcagattctatttttcaagacattacaaacaattat
ttagcggcaaaagaattagcagcaaaagctacaaatagacctactgtaataagcggtgca
atttacaatgatgtttggtatttacctggtggaaaaagctgggcttccaaatttattgaa
gatgccaatgctgcttatatgtttaaagacacggaagaaacaggtagtttatctttgagt
tgggaaagtgttttggaaaaaggaaaaaaagctaatttctggatttctccttctcaattt
acttcgtataaagatatgacagcgaacagtcaacattacggacagtttgatgcttttaaa
aagaaaaaagtgtactcttttgcaggtactactggtgaaactggcggacttttatattat
gaattagcaccaaatagacccgatctagttcttaaagatttaattcatatatttcaccca
gatctattgccaaactatattccaactttttttaaaccattagattaa

DBGET integrated database retrieval system